• Gene id: 246175

Gene Summary

• Gene Symbol: CNOT6L   Gene   UCSC   Ensembl
• Aliases: CCR4b
• Gene name: CCR4-NOT transcription complex subunit 6 like
• Alternate names: CCR4-NOT transcription complex subunit 6-like, carbon catabolite repressor protein 4 homolog B,
• Gene location: 4q21.1 (77820268: 77713386)     Exons: 16     NC_000004.12
• OMIM: 618069

Protein Summary

• Protein general information: Q96LI5  
  • Name: CCR4 NOT transcription complex subunit 6 like (EC 3.1.13.4) (Carbon catabolite repressor protein 4 homolog B)
  • Length: 555  
  • Mass: 63001
  • Tissue specificity: Highly expressed in placenta, skeletal muscle, pancreas, testis and leukocytes. Weakly expressed in heart, spleen and thymus. {ECO
• Sequence:

  MRLIGMPKEKYDPPDPRRIYTIMSAEEVANGKKSHWAELEISGRVRSLSTSLWSLTHLTALHLNDNYLSRIPPDI
  AKLHNLVYLDLSSNKLRSLPAELGNMVSLRELLLNNNLLRVLPYELGRLFQLQTLGLKGNPLSQDILNLYQDPDG
  TRKLLNFMLDNLAVHPEQLPPRPWITLKERDQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIM
  EEIVNCDADIISLQEVETEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTV
  EFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAADKQLLIVANAHMHWDPEYSDVKLIQT
  MMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVVEYLSNGGVADNHKDFKELRYNECLMNFSCN
  GKNGSSEGRITHGFQLKSAYENNLMPYTNYTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHI
  PSDHFSLLTQLELHPPLLPLVNGVHLPNRR

• Structural information:
  • Interpro: IPR034967  IPR036691  IPR005135  IPR001611  IPR003591   IPR032675  
  • Prosite: PS51450
  • CDD: cd10312
  • PDB: 3NGN 3NGO 3NGQ 5DV2 5DV4
  • PDBsum: 3NGN 3NGO 3NGQ 5DV2 5DV4
  • DIP: 46837
  • STRING: ENSP00000424896
• Other Databases: GeneCards:  CNOT6L  Malacards:  CNOT6L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000175	3'-5'-exoribonuclease activity	IBA	molecular function
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0004535	poly(A)-specific ribonuclease activity	IBA	molecular function
GO:0030014	CCR4-NOT complex	IBA	cellular component
GO:0030014	CCR4-NOT complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0010606	positive regulation of cytoplasmic mRNA processing body assembly	IMP	biological process
GO:0004535	poly(A)-specific ribonuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0004518	nuclease activity	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0004527	exonuclease activity	IEA	molecular function
GO:0004535	poly(A)-specific ribonuclease activity	IEA	molecular function
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	TAS	biological process
GO:0004535	poly(A)-specific ribonuclease activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0061157	mRNA destabilization	IEA	biological process
GO:0000288	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IEA	biological process
GO:0004535	poly(A)-specific ribonuclease activity	IEA	molecular function
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)