• Gene id: 245938

Gene Summary

• Gene Symbol: DEFB125   Gene   UCSC   Ensembl
• Aliases: DEFB-25
• Gene name: defensin beta 125
• Alternate names: beta-defensin 125, beta defensin 25,
• Gene location: 20p13 (87671: 97093)     Exons: 2     NC_000020.11
• Gene summary(Entrez): Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin

Protein Summary

• Protein general information: Q8N687  
  • Name: Beta defensin 125 (Beta defensin 25) (DEFB 25) (Defensin, beta 125)
  • Length: 156  
  • Mass: 17537
• Sequence:

  MNILMLTFIICGLLTRVTKGSFEPQKCWKNNVGHCRRRCLDTERYILLCRNKLSCCISIISHEYTRRPAFPVIHL
  EDITLDYSDVDSFTGSPVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETATSETMPPPSQ
  TALTHN

• Structural information:
  • Interpro: IPR025933  
  • STRING: ENSP00000371847
• Other Databases: GeneCards:  DEFB125  Malacards:  DEFB125

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006952	defense response	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881