• Gene id: 24147

Gene Summary

• Gene Symbol: FJX1   Gene   UCSC   Ensembl
• Gene name: four-jointed box kinase 1
• Alternate names: four-jointed box protein 1, four jointed box 1, four-jointed protein homolog, putative secreted ligand homologous to fjx1,
• Gene location: 11p13 (35618459: 35620864)     Exons: 1     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of t
• OMIM: 612206

Protein Summary

• Protein general information: Q86VR8  
  • Name: Four jointed box protein 1 (Four jointed protein homolog)
  • Length: 437  
  • Mass: 48507
• Sequence:

  MGRRMRGAAATAGLWLLALGSLLALWGGLLPPRTELPASRPPEDRLPRRPARSGGPAPAPRFPLPPPLAWDARGG
  SLKTFRALLTLAAGADGPPRQSRSEPRWHVSARQPRPEESAAVHGGVFWSRGLEEQVPPGFSEAQAAAWLEAARG
  ARMVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLGLQRHVPPLALARVEARGAQWAQV
  QEELRAAHWTEGSVVSLTRWLPNLTDVVVPAPWRSEDGRLRPLRDAGGELANLSQAELVDLVQWTDLILFDYLTA
  NFDRLVSNLFSLQWDPRVMQRATSNLHRGPGGALVFLDNEAGLVHGYRVAGMWDKYNEPLLQSVCVFRERTARRV
  LELHRGQDAAARLLRLYRRHEPRFPELAALADPHAQLLQRRLDFLAKHILHCKAKYGRRSGT

• Structural information:
  • Interpro: IPR024868  
  • STRING: ENSP00000400223
• Other Databases: GeneCards:  FJX1  Malacards:  FJX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0007267	cell-cell signaling	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0010842	retina layer formation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)