• Gene id: 24145

Gene Summary

• Gene Symbol: PANX1   Gene   UCSC   Ensembl
• Aliases: MRS1, OOMD7, PX1, UNQ2529
• Gene name: pannexin 1
• Alternate names: pannexin-1, innexin,
• Gene location: 11q21 (100644198: 100675787)     Exons: 11     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuron
• OMIM: 608420

Protein Summary

• Protein general information: Q96RD7  
  • Name: Pannexin 1
  • Length: 426  
  • Mass: 48050
  • Tissue specificity: Widely expressed (PubMed
• Sequence:

  MAIAQLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISIGTQISCFSPSSFSWR
  QAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILLYLPPLFWRFAAAPHICSDLKFIMEELDKVY
  NRAIKAAKSARDLDMRDGACSVPGVTENLGQSLWEVSESHFKYPIVEQYLKTKKNSNNLIIKYISCRLLTLIIIL
  LACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTLFVPFR
  QKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKM
  DVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC

• Structural information:
  • Interpro: IPR000990  IPR039099  
  • Prosite: PS51013
  • DIP: 43936
  • STRING: ENSP00000227638
• Other Databases: GeneCards:  PANX1  Malacards:  PANX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022829	wide pore channel activity	IBA	molecular function
GO:0007267	cell-cell signaling	IBA	biological process
GO:0006812	cation transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0006812	cation transport	IEA	biological process
GO:0015267	channel activity	IEA	molecular function
GO:0050716	positive regulation of interleukin-1 secretion	IEA	biological process
GO:0006816	calcium ion transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005262	calcium channel activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0048477	oogenesis	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005921	gap junction	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002931	response to ischemia	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0015267	channel activity	IEA	molecular function
GO:0050715	positive regulation of cytokine secretion	IEA	biological process
GO:0050717	positive regulation of interleukin-1 alpha secretion	IEA	biological process
GO:0051015	actin filament binding	IEA	molecular function
GO:0005243	gap junction channel activity	IEA	molecular function
GO:0007267	cell-cell signaling	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0044325	ion channel binding	IEA	molecular function
GO:0005198	structural molecule activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0033198	response to ATP	IEA	biological process
GO:0050718	positive regulation of interleukin-1 beta secretion	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0097110	scaffold protein binding	IEA	molecular function
GO:0002020	protease binding	IEA	molecular function
GO:0006812	cation transport	IDA	biological process
GO:0032059	bleb	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0050718	positive regulation of interleukin-1 beta secretion	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005921	gap junction	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0006816	calcium ion transport	IMP	biological process
GO:0022840	leak channel activity	IMP	molecular function
GO:0005262	calcium channel activity	IMP	molecular function
GO:0055077	gap junction hemi-channel activity	ISS	NOT|molecular function
GO:0005198	structural molecule activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04621	NOD-like receptor signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)