• Gene id: 24139

Gene Summary

• Gene Symbol: EML2   Gene   UCSC   Ensembl
• Aliases: ELP70, EMAP-2, EMAP2
• Gene name: EMAP like 2
• Alternate names: echinoderm microtubule-associated protein-like 2, echinoderm MT-associated protein (EMAP)-like protein 70, echinoderm microtubule associated protein like 2, microtubule-associated protein like echinoderm EMAP,
• Gene location: 19q13.32 (45645628: 45609395)     Exons: 27     NC_000019.10
• OMIM: 600404

Protein Summary

• Protein general information: O95834  
  • Name: Echinoderm microtubule associated protein like 2 (EMAP 2) (HuEMAP 2)
  • Length: 649  
  • Mass: 70679
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLL
  PTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTL
  HVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCG
  KSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGL
  CALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQG
  HVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETH
  DLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSSCFVTNS
  GDYEILYWDPATCKQITSADAVRNMEWATATCVLGFGVFGIWSEGADGTDINAVARSHDGKLLASADDFGKVHLF
  SYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRVV

• Structural information:
  • Interpro: IPR005108  IPR011047  IPR015943  IPR001680  IPR017986   IPR036322  
  • Prosite: PS50082 PS50294
  • PDB: 4CGB
  • PDBsum: 4CGB
  • STRING: ENSP00000468312
• Other Databases: GeneCards:  EML2  Malacards:  EML2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008017	microtubule binding	IBA	molecular function
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0072686	mitotic spindle	IBA	colocalizes with
GO:0031115	negative regulation of microtubule polymerization	IDA	biological process
GO:0010968	regulation of microtubule nucleation	IDA	biological process
GO:0008017	microtubule binding	IDA	molecular function
GO:0015631	tubulin binding	IDA	molecular function
GO:0072686	mitotic spindle	IDA	colocalizes with
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005875	microtubule associated complex	TAS	cellular component
GO:0007605	sensory perception of sound	TAS	biological process
GO:0007601	visual perception	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0008017	microtubule binding	IBA	molecular function
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0072686	mitotic spindle	IBA	colocalizes with
GO:0031115	negative regulation of microtubule polymerization	IDA	biological process
GO:0010968	regulation of microtubule nucleation	IDA	biological process
GO:0008017	microtubule binding	IDA	molecular function
GO:0015631	tubulin binding	IDA	molecular function
GO:0072686	mitotic spindle	IDA	colocalizes with
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005875	microtubule associated complex	TAS	cellular component
GO:0007605	sensory perception of sound	TAS	biological process
GO:0007601	visual perception	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005819	spindle	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq