• Gene id: 240

Gene Summary

• Gene Symbol: ALOX5   Gene   UCSC   Ensembl
• Aliases: 5-LO, 5-LOX, 5LPG, LOG5
• Gene name: arachidonate 5-lipoxygenase
• Alternate names: arachidonate 5-lipoxygenase, LOX-5, arachidonic 5-lipoxygenase alpha-10 isoform, arachidonic 5-lipoxygenase delta-10-13 isoform, arachidonic 5-lipoxygenase delta-13 isoform, arachidonic 5-lipoxygenase delta-p10 isoform, arachidonic acid 5-lipoxygenase, leukotrie,
• Gene location: 10q11.21 (45374165: 45446120)     Exons: 13     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachid
• OMIM: 152390

SNPs

rs12870438

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000013.11   g.42906069G>A
NC_000013.10   g.43480205G>A
NG_051573.1   g.91244C>T|SEQ=[G/A]|GENE=EPSTI1

Protein Summary

• Protein general information: P09917  
  • Name: Arachidonate 5 lipoxygenase (5 LO) (5 lipoxygenase) (EC 1.13.11.34)
  • Length: 674  
  • Mass: 77983
• Sequence:

  MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKY
  WLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNP
  GFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMN
  HWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP
  CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLV
  SEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLC
  FPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSG
  FPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
  HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI

• Structural information:
  • Protein Domains: (2..11-)
    (/note="PLAT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00152-)
    (119..67-)
    (/note="Lipoxygenase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00726"-)
  • Interpro: IPR000907  IPR013819  IPR036226  IPR020834  IPR020833   IPR001885  IPR001024  IPR036392  IPR042062  
  • Prosite: PS00711 PS00081 PS51393 PS50095
  • CDD: cd01753
  • PDB: 2ABV 3O8Y 3V92 3V98 3V99
  • PDBsum: 2ABV 3O8Y 3V92 3V98 3V99
  • DIP: 30950
  • STRING: ENSP00000363512
• Other Databases: GeneCards:  ALOX5  Malacards:  ALOX5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0016702	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IBA	molecular function
GO:0019372	lipoxygenase pathway	IBA	biological process
GO:0004051	arachidonate 5-lipoxygenase activity	IBA	molecular function
GO:0005635	nuclear envelope	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0019369	arachidonic acid metabolic process	IBA	biological process
GO:0034440	lipid oxidation	IBA	biological process
GO:0051122	hepoxilin biosynthetic process	IBA	biological process
GO:0005506	iron ion binding	IDA	molecular function
GO:0019370	leukotriene biosynthetic process	IDA	biological process
GO:0004051	arachidonate 5-lipoxygenase activity	IDA	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	IDA	molecular function
GO:0019370	leukotriene biosynthetic process	IDA	biological process
GO:0004051	arachidonate 5-lipoxygenase activity	IDA	molecular function
GO:1901753	leukotriene A4 biosynthetic process	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0004051	arachidonate 5-lipoxygenase activity	IDA	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	IDA	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	IDA	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	IDA	molecular function
GO:0050728	negative regulation of inflammatory response	IDA	biological process
GO:0004051	arachidonate 5-lipoxygenase activity	IDA	molecular function
GO:0061044	negative regulation of vascular wound healing	ISS	biological process
GO:0042593	glucose homeostasis	ISS	biological process
GO:1901753	leukotriene A4 biosynthetic process	IMP	biological process
GO:2001301	lipoxin biosynthetic process	IMP	biological process
GO:0030501	positive regulation of bone mineralization	ISS	biological process
GO:0006959	humoral immune response	ISS	biological process
GO:1903671	negative regulation of sprouting angiogenesis	ISS	biological process
GO:0016525	negative regulation of angiogenesis	ISS	biological process
GO:0001937	negative regulation of endothelial cell proliferation	ISS	biological process
GO:0050727	regulation of inflammatory response	IMP	biological process
GO:0002232	leukocyte chemotaxis involved in inflammatory response	IMP	biological process
GO:0002523	leukocyte migration involved in inflammatory response	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061045	negative regulation of wound healing	ISS	biological process
GO:0050796	regulation of insulin secretion	ISS	biological process
GO:0036336	dendritic cell migration	ISS	biological process
GO:1903426	regulation of reactive oxygen species biosynthetic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045598	regulation of fat cell differentiation	ISS	biological process
GO:1903573	negative regulation of response to endoplasmic reticulum stress	ISS	biological process
GO:1900407	regulation of cellular response to oxidative stress	ISS	biological process
GO:1900015	regulation of cytokine production involved in inflammatory response	ISS	biological process
GO:0106014	regulation of inflammatory response to wounding	ISS	biological process
GO:1904999	positive regulation of leukocyte adhesion to arterial endothelial cell	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005506	iron ion binding	IEA	molecular function
GO:0016702	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0019370	leukotriene biosynthetic process	IEA	biological process
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0006691	leukotriene metabolic process	TAS	biological process
GO:0004051	arachidonate 5-lipoxygenase activity	IEA	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0004051	arachidonate 5-lipoxygenase activity	TAS	molecular function
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:2001301	lipoxin biosynthetic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006691	leukotriene metabolic process	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0019372	lipoxygenase pathway	TAS	biological process
GO:0019372	lipoxygenase pathway	TAS	biological process
GO:0019372	lipoxygenase pathway	TAS	biological process
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0035655	interleukin-18-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903671	negative regulation of sprouting angiogenesis	IEA	biological process
GO:1901753	leukotriene A4 biosynthetic process	IEA	biological process
GO:0061044	negative regulation of vascular wound healing	IEA	biological process
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0030501	positive regulation of bone mineralization	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0006959	humoral immune response	IEA	biological process
GO:0006691	leukotriene metabolic process	IEA	biological process
GO:0002540	leukotriene production involved in inflammatory response	IEA	biological process
GO:0002523	leukocyte migration involved in inflammatory response	IEA	biological process
GO:0001937	negative regulation of endothelial cell proliferation	IEA	biological process
GO:1904999	positive regulation of leukocyte adhesion to arterial endothelial cell	IEA	biological process
GO:1903573	negative regulation of response to endoplasmic reticulum stress	IEA	biological process
GO:1900407	regulation of cellular response to oxidative stress	IEA	biological process
GO:1900015	regulation of cytokine production involved in inflammatory response	IEA	biological process
GO:0106014	regulation of inflammatory response to wounding	IEA	biological process
GO:0061045	negative regulation of wound healing	IEA	biological process
GO:0050796	regulation of insulin secretion	IEA	biological process
GO:0045598	regulation of fat cell differentiation	IEA	biological process
GO:0036336	dendritic cell migration	IEA	biological process
GO:0019370	leukotriene biosynthetic process	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004051	arachidonate 5-lipoxygenase activity	IEA	molecular function
GO:0016363	nuclear matrix	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005641	nuclear envelope lumen	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005641	nuclear envelope lumen	IDA	cellular component
GO:0016363	nuclear matrix	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04726	Serotonergic synapse
hsa05145	Toxoplasmosis
hsa04664	Fc epsilon RI signaling pathway
hsa00590	Arachidonic acid metabolism
hsa04913	Ovarian steroidogenesis

Diseases

Associated diseases	References
pancreatic cancer	PMID:12163367
pancreatic cancer	PMID:12481414
Arteriosclerosis	PMID:14702425
Asthma	PMID:9642160
Asthma	PMID:17394438
Pulmonary fibrosis	PMID:8621765
cholangiocarcinoma	PMID:18507031
Pulmonary hypertension	PMID:9445303
Pulmonary hypertension	PMID:31462075
in situ carcinoma	PMID:16024599
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq