• Gene id: 23780

Gene Summary

• Gene Symbol: APOL2   Gene   UCSC   Ensembl
• Aliases: APOL-II, APOL3
• Gene name: apolipoprotein L2
• Alternate names: apolipoprotein L2, apolipoprotein L, 2, apolipoprotein L-II,
• Gene location: 22q12.3 (36239953: 36226208)     Exons: 3     NC_000022.11
• Gene summary(Entrez): This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. Two transcript variants encoding the same protein have been
• OMIM: 607252

Protein Summary

• Protein general information: Q9BQE5  
  • Name: Apolipoprotein L2 (Apolipoprotein L II) (ApoL II)
  • Length: 337  
  • Mass: 37092
  • Tissue specificity: Widely expressed; the highest levels are found in lung, thymus, pancreas, placenta, adult brain and prostate; also detected in spleen, liver, kidney, colon, small intestine, uterus, spinal cord, adrenal gland, salivary gland, trachea,
• Sequence:

  MNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNRHDKDQ
  QHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHRGTTIANVVSNSVGTTSGILTLLGLGLAPFTEGISFVLLD
  TGMGLGAAAAVAGITCSVVELVNKLRARAQARNLDQSGTNVAKVMKEFVGGNTPNVLTLVDNWYQVTQGIGRNIR
  AIRRARANPQLGAYAPPPHIIGRISAEGGEQVERVVEGPAQAMSRGTMIVGAATGGILLLLDVVSLAYESKHLLE
  GAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQDQ

• Structural information:
  • Interpro: IPR008405  
  • STRING: ENSP00000249066
• Other Databases: GeneCards:  APOL2  Malacards:  APOL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0042157	lipoprotein metabolic process	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	NAS	biological process
GO:0006953	acute-phase response	NAS	biological process
GO:0006869	lipid transport	NAS	biological process
GO:0006629	lipid metabolic process	NAS	biological process
GO:0008289	lipid binding	NAS	molecular function
GO:0005789	endoplasmic reticulum membrane	NAS	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0008203	cholesterol metabolic process	NAS	biological process
GO:0008035	high-density lipoprotein particle binding	NAS	molecular function
GO:0006629	lipid metabolic process	NAS	biological process
GO:0005102	signaling receptor binding	NAS	molecular function
GO:0060135	maternal process involved in female pregnancy	NAS	biological process

Diseases

Associated diseases	References
Schizophrenia	KEGG:H01649
Schizophrenia	KEGG:H01649
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)