About Us

Search Result


Gene id 23767
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol FLRT3   Gene   UCSC   Ensembl
Aliases HH21
Gene name fibronectin leucine rich transmembrane protein 3
Alternate names leucine-rich repeat transmembrane protein FLRT3, fibronectin-like domain-containing leucine-rich transmembrane protein 3,
Gene location 20p12.1 (14337846: 14322984)     Exons: 4     NC_000020.11
Gene summary(Entrez) This gene encodes a member of the fibronectin leucine rich transmembrane protein (FLRT) family. FLRTs may function in cell adhesion and/or receptor signalling. Their protein structures resemble small leucine-rich proteoglycans found in the extracellular m
OMIM 604808

Protein Summary

Protein general information Q9NZU0  

Name: Leucine rich repeat transmembrane protein FLRT3 (Fibronectin like domain containing leucine rich transmembrane protein 3)

Length: 649  Mass: 73,004

Sequence MISAAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQINNAGI
PSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAF
RDSNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLV
NLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQL
ILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELFDCKDSGIVSTIQITTAIPNTVY
PAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPSRKTITITVKSVTSDTIHISWKLALPMTALRLSWLKLGHSPAFG
SITETIVTGERSEYLVTALEPDSPYKVCMVPMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNP
NLPLAAIIGGAVALVTIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPIS
NEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS
Structural information
Protein Domains
LRRNT. (29-58)
LRRCT. (305-357)
Fibronectin (409-504)
Interpro:  IPR000483  IPR003961  IPR036116  IPR013783  IPR001611  
IPR003591  IPR032675  IPR000372  
Prosite:   PS50853 PS51450
CDD:   cd00063

PDB:  
5CMN 5CMP
PDBsum:   5CMN 5CMP

DIP:  

50407

STRING:   ENSP00000339912
Other Databases GeneCards:  FLRT3  Malacards:  FLRT3

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0003345 proepicardium cell migrat
ion involved in pericardi
um morphogenesis
ISS biological process
GO:0004860 protein kinase inhibitor
activity
IBA molecular function
GO:0005057 signal transducer activit
y, downstream of receptor
NAS molecular function
GO:0005104 fibroblast growth factor
receptor binding
IEA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005578 proteinaceous extracellul
ar matrix
NAS cellular component
GO:0005615 extracellular space
IEA cellular component
GO:0005737 cytoplasm
IBA cellular component
GO:0005789 endoplasmic reticulum mem
brane
IEA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005887 integral component of pla
sma membrane
NAS cellular component
GO:0005887 integral component of pla
sma membrane
IDA cellular component
GO:0005887 integral component of pla
sma membrane
IDA cellular component
GO:0005911 cell-cell junction
IEA cellular component
GO:0005925 focal adhesion
IEA cellular component
GO:0006469 negative regulation of pr
otein kinase activity
IBA biological process
GO:0007411 axon guidance
IEA biological process
GO:0007416 synapse assembly
ISS biological process
GO:0007507 heart development
ISS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
ISS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0019221 cytokine-mediated signali
ng pathway
IBA biological process
GO:0030674 protein binding, bridging
NAS molecular function
GO:0031175 neuron projection develop
ment
ISS biological process
GO:0042803 protein homodimerization
activity
IDA molecular function
GO:0043679 axon terminus
ISS cellular component
GO:0044295 axonal growth cone
ISS cellular component
GO:0045499 chemorepellent activity
IEA molecular function
GO:0046426 negative regulation of JA
K-STAT cascade
IBA biological process
GO:0048598 embryonic morphogenesis
ISS biological process
GO:0048678 response to axon injury
ISS biological process
GO:0050919 negative chemotaxis
IEA biological process
GO:0051965 positive regulation of sy
napse assembly
IEA biological process
GO:0060322 head development
ISS biological process
GO:0097060 synaptic membrane
ISS cellular component
GO:0098609 cell-cell adhesion
IDA biological process
GO:1990138 neuron projection extensi
on
ISS biological process
GO:1990138 neuron projection extensi
on
IMP biological process
GO:0003345 proepicardium cell migrat
ion involved in pericardi
um morphogenesis
IEA biological process
GO:0003345 proepicardium cell migrat
ion involved in pericardi
um morphogenesis
ISS biological process
GO:0004860 protein kinase inhibitor
activity
IBA molecular function
GO:0005057 signal transducer activit
y, downstream of receptor
NAS molecular function
GO:0005104 fibroblast growth factor
receptor binding
IEA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
IEA cellular component
GO:0005578 proteinaceous extracellul
ar matrix
NAS cellular component
GO:0005615 extracellular space
IEA cellular component
GO:0005737 cytoplasm
IBA cellular component
GO:0005783 endoplasmic reticulum
IEA cellular component
GO:0005789 endoplasmic reticulum mem
brane
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005887 integral component of pla
sma membrane
IEA cellular component
GO:0005887 integral component of pla
sma membrane
NAS cellular component
GO:0005887 integral component of pla
sma membrane
IDA cellular component
GO:0005887 integral component of pla
sma membrane
IDA cellular component
GO:0005911 cell-cell junction
IEA cellular component
GO:0005925 focal adhesion
IEA cellular component
GO:0005925 focal adhesion
IEA cellular component
GO:0006469 negative regulation of pr
otein kinase activity
IBA biological process
GO:0007155 cell adhesion
IEA biological process
GO:0007275 multicellular organism de
velopment
IEA biological process
GO:0007411 axon guidance
IEA biological process
GO:0007416 synapse assembly
IEA biological process
GO:0007416 synapse assembly
ISS biological process
GO:0007507 heart development
IEA biological process
GO:0007507 heart development
ISS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IEA biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
ISS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0016020 membrane
IEA cellular component
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0019221 cytokine-mediated signali
ng pathway
IBA biological process
GO:0030054 cell junction
IEA cellular component
GO:0030424 axon
IEA cellular component
GO:0030674 protein binding, bridging
NAS molecular function
GO:0031175 neuron projection develop
ment
IEA biological process
GO:0031175 neuron projection develop
ment
ISS biological process
GO:0042803 protein homodimerization
activity
IDA molecular function
GO:0042995 cell projection
IEA cellular component
GO:0043679 axon terminus
ISS cellular component
GO:0044295 axonal growth cone
IEA cellular component
GO:0044295 axonal growth cone
ISS cellular component
GO:0045499 chemorepellent activity
IEA molecular function
GO:0046426 negative regulation of JA
K-STAT cascade
IBA biological process
GO:0048598 embryonic morphogenesis
IEA biological process
GO:0048598 embryonic morphogenesis
ISS biological process
GO:0048678 response to axon injury
ISS biological process
GO:0050919 negative chemotaxis
IEA biological process
GO:0051965 positive regulation of sy
napse assembly
IEA biological process
GO:0060322 head development
IEA biological process
GO:0060322 head development
ISS biological process
GO:0097060 synaptic membrane
ISS cellular component
GO:0098609 cell-cell adhesion
IEA biological process
GO:0098609 cell-cell adhesion
IDA biological process
GO:1990138 neuron projection extensi
on
ISS biological process
GO:1990138 neuron projection extensi
on
IMP biological process
GO:0003345 proepicardium cell migrat
ion involved in pericardi
um morphogenesis
ISS biological process
GO:0004860 protein kinase inhibitor
activity
IBA molecular function
GO:0005057 signal transducer activit
y, downstream of receptor
NAS molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005578 proteinaceous extracellul
ar matrix
NAS cellular component
GO:0005737 cytoplasm
IBA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005887 integral component of pla
sma membrane
NAS cellular component
GO:0005887 integral component of pla
sma membrane
IDA cellular component
GO:0005887 integral component of pla
sma membrane
IDA cellular component
GO:0006469 negative regulation of pr
otein kinase activity
IBA biological process
GO:0007416 synapse assembly
ISS biological process
GO:0007507 heart development
ISS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
ISS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0019221 cytokine-mediated signali
ng pathway
IBA biological process
GO:0030674 protein binding, bridging
NAS molecular function
GO:0031175 neuron projection develop
ment
ISS biological process
GO:0042803 protein homodimerization
activity
IDA molecular function
GO:0043679 axon terminus
ISS cellular component
GO:0044295 axonal growth cone
ISS cellular component
GO:0046426 negative regulation of JA
K-STAT cascade
IBA biological process
GO:0048598 embryonic morphogenesis
ISS biological process
GO:0048678 response to axon injury
ISS biological process
GO:0060322 head development
ISS biological process
GO:0097060 synaptic membrane
ISS cellular component
GO:0098609 cell-cell adhesion
IDA biological process
GO:1990138 neuron projection extensi
on
ISS biological process
GO:1990138 neuron projection extensi
on
IMP biological process
Associated diseases References
Multiple Mental Retardation Syndrome GAD: 18593871
Kallmann syndrome (KS) INFBASE: 23643382
Congenital hypogonadotropic hypogonadism (CHH) MIK: 23643382
Hypogonadotropic hypogonadism OMIM: 604808, KEGG: H00255
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Congenital hypogonadotropic hypogonadism (CHH) MIK: 23643382
Kallmann syndrome (KS) MIK: 23643382
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
23643382 Congenital
hypogonad
otropic hy
pogonadism
(CHH), Ka
llmann syn
drome (KS)

541 (386 unrela
ted CHH individ
uals, 155 contr
ols)
Male infertility FGF17
IL17RD
DUSP6
SPRY4
and FLRT3
Show abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract