• Gene id: 23767

Gene Summary

• Gene Symbol: FLRT3   Gene   UCSC   Ensembl
• Aliases: HH21
• Gene name: fibronectin leucine rich transmembrane protein 3
• Alternate names: leucine-rich repeat transmembrane protein FLRT3, fibronectin-like domain-containing leucine-rich transmembrane protein 3,
• Gene location: 20p12.1 (14337846: 14322984)     Exons: 4     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the fibronectin leucine rich transmembrane protein (FLRT) family. FLRTs may function in cell adhesion and/or receptor signalling. Their protein structures resemble small leucine-rich proteoglycans found in the extracellular m
• OMIM: 604808

Protein Summary

• Protein general information: Q9NZU0  
  • Name: Leucine rich repeat transmembrane protein FLRT3 (Fibronectin like domain containing leucine rich transmembrane protein 3)
  • Length: 649  
  • Mass: 73,004
• Sequence:

  MISAAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQINNAGI
  PSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAF
  RDSNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLV
  NLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQL
  ILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELFDCKDSGIVSTIQITTAIPNTVY
  PAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPSRKTITITVKSVTSDTIHISWKLALPMTALRLSWLKLGHSPAFG
  SITETIVTGERSEYLVTALEPDSPYKVCMVPMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNP
  NLPLAAIIGGAVALVTIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPIS
  NEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS

• Structural information:
  • Protein Domains: LRRNT. (29-58)
    LRRCT. (305-357)
    Fibronectin (409-504)
  • Interpro: IPR000483  IPR003961  IPR036116  IPR013783  IPR001611   IPR003591  IPR032675  IPR000372  
  • Prosite: PS50853 PS51450
  • CDD: cd00063
  • PDB: 5CMN 5CMP
  • PDBsum: 5CMN 5CMP
  • DIP: 50407
  • STRING: ENSP00000339912
• Other Databases: GeneCards:  FLRT3  Malacards:  FLRT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003345	proepicardium cell migration involved in pericardium morphogenesis	ISS	biological process
GO:0004860	protein kinase inhibitor activity	IBA	molecular function
GO:0005057	signal transducer activity, downstream of receptor	NAS	molecular function
GO:0005104	fibroblast growth factor receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005578	proteinaceous extracellular matrix	NAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005911	cell-cell junction	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0007416	synapse assembly	ISS	biological process
GO:0007507	heart development	ISS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	ISS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0030674	protein binding, bridging	NAS	molecular function
GO:0031175	neuron projection development	ISS	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043679	axon terminus	ISS	cellular component
GO:0044295	axonal growth cone	ISS	cellular component
GO:0045499	chemorepellent activity	IEA	molecular function
GO:0046426	negative regulation of JAK-STAT cascade	IBA	biological process
GO:0048598	embryonic morphogenesis	ISS	biological process
GO:0048678	response to axon injury	ISS	biological process
GO:0050919	negative chemotaxis	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0060322	head development	ISS	biological process
GO:0097060	synaptic membrane	ISS	cellular component
GO:0098609	cell-cell adhesion	IDA	biological process
GO:1990138	neuron projection extension	ISS	biological process
GO:1990138	neuron projection extension	IMP	biological process
GO:0003345	proepicardium cell migration involved in pericardium morphogenesis	IEA	biological process
GO:0003345	proepicardium cell migration involved in pericardium morphogenesis	ISS	biological process
GO:0004860	protein kinase inhibitor activity	IBA	molecular function
GO:0005057	signal transducer activity, downstream of receptor	NAS	molecular function
GO:0005104	fibroblast growth factor receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	NAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005911	cell-cell junction	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0007416	synapse assembly	IEA	biological process
GO:0007416	synapse assembly	ISS	biological process
GO:0007507	heart development	IEA	biological process
GO:0007507	heart development	ISS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	ISS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030674	protein binding, bridging	NAS	molecular function
GO:0031175	neuron projection development	IEA	biological process
GO:0031175	neuron projection development	ISS	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0043679	axon terminus	ISS	cellular component
GO:0044295	axonal growth cone	IEA	cellular component
GO:0044295	axonal growth cone	ISS	cellular component
GO:0045499	chemorepellent activity	IEA	molecular function
GO:0046426	negative regulation of JAK-STAT cascade	IBA	biological process
GO:0048598	embryonic morphogenesis	IEA	biological process
GO:0048598	embryonic morphogenesis	ISS	biological process
GO:0048678	response to axon injury	ISS	biological process
GO:0050919	negative chemotaxis	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0060322	head development	IEA	biological process
GO:0060322	head development	ISS	biological process
GO:0097060	synaptic membrane	ISS	cellular component
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0098609	cell-cell adhesion	IDA	biological process
GO:1990138	neuron projection extension	ISS	biological process
GO:1990138	neuron projection extension	IMP	biological process
GO:0003345	proepicardium cell migration involved in pericardium morphogenesis	ISS	biological process
GO:0004860	protein kinase inhibitor activity	IBA	molecular function
GO:0005057	signal transducer activity, downstream of receptor	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005578	proteinaceous extracellular matrix	NAS	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0007416	synapse assembly	ISS	biological process
GO:0007507	heart development	ISS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	ISS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0030674	protein binding, bridging	NAS	molecular function
GO:0031175	neuron projection development	ISS	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043679	axon terminus	ISS	cellular component
GO:0044295	axonal growth cone	ISS	cellular component
GO:0046426	negative regulation of JAK-STAT cascade	IBA	biological process
GO:0048598	embryonic morphogenesis	ISS	biological process
GO:0048678	response to axon injury	ISS	biological process
GO:0060322	head development	ISS	biological process
GO:0097060	synaptic membrane	ISS	cellular component
GO:0098609	cell-cell adhesion	IDA	biological process
GO:1990138	neuron projection extension	ISS	biological process
GO:1990138	neuron projection extension	IMP	biological process

Diseases

Associated diseases	References
Multiple Mental Retardation Syndrome	GAD: 18593871
Kallmann syndrome (KS)	INFBASE: 23643382
Congenital hypogonadotropic hypogonadism (CHH)	MIK: 23643382
Hypogonadotropic hypogonadism	OMIM: 604808, KEGG: H00255
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Congenital hypogonadotropic hypogonadism (CHH)	MIK: 23643382
Kallmann syndrome (KS)	MIK: 23643382
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23643382	Congenital hypogonadotropic hypogonadism (CHH), Kallmann syndrome (KS)			541 (386 unrelated CHH individuals, 155 controls)	Male infertility	FGF17 IL17RD DUSP6 SPRY4 and FLRT3
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881