• Gene id: 23765

Gene Summary

• Gene Symbol: IL17RA   Gene   UCSC   Ensembl
• Aliases: CANDF5, CD217, CDw217, IL-17RA, IL17R, IMD51, hIL-17R
• Gene name: interleukin 17 receptor A
• Alternate names: interleukin-17 receptor A, IL-17 receptor A,
• Gene location: 22q11.1 (17084958: 17115693)     Exons: 13     NC_000022.11
• Gene summary(Entrez): Interleukin 17A (IL17A) is a proinflammatory cytokine secreted by activated T-lymphocytes. It is a potent inducer of the maturation of CD34-positive hematopoietic precursors into neutrophils. The transmembrane protein encoded by this gene (interleukin 17A
• OMIM: 612747

Protein Summary

• Protein general information: Q96F46  
  • Name: Interleukin 17 receptor A (IL 17 receptor A) (IL 17RA) (CDw217) (CD antigen CD217)
  • Length: 866  
  • Mass: 96122
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MGAARSPPSAVPGPLLGLLLLLLGVLAPGGASLRLLDHRALVCSQPGLNCTVKNSTCLDDSWIHPRNLTPSSPKD
  LQIQLHFAHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLNTNERLCVRFEFLSKLRHHHRRWRFTFSHFV
  VDPDQEYEVTVHHLPKPIPDGDPNHQSKNFLVPDCEHARMKVTTPCMSSGSLWDPNITVETLEAHQLRVSFTLWN
  ESTHYQILLTSFPHMENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQVQIQPFFSSCLNDCLRHSAT
  VSCPEMPDTPEPIPDYMPLWVYWFITGISILLVGSVILLIVCMTWRLAGPGSEKYSDDTKYTDGLPAADLIPPPL
  KPRKVWIIYSADHPLYVDVVLKFAQFLLTACGTEVALDLLEEQAISEAGVMTWVGRQKQEMVESNSKIIVLCSRG
  TRAKWQALLGRGAPVRLRCDHGKPVGDLFTAAMNMILPDFKRPACFGTYVVCYFSEVSCDGDVPDLFGAAPRYPL
  MDRFEEVYFRIQDLEMFQPGRMHRVGELSGDNYLRSPGGRQLRAALDRFRDWQVRCPDWFECENLYSADDQDAPS
  LDEEVFEEPLLPPGTGIVKRAPLVREPGSQACLAIDPLVGEEGGAAVAKLEPHLQPRGQPAPQPLHTLVLAAEEG
  ALVAAVEPGPLADGAAVRLALAGEGEACPLLGSPGAGRNSVLFLPVDPEDSPLGSSTPMASPDLLPEDVREHLEG
  LMLSLFEQSLSCQAQGGCSRPAMVLTDPHTPYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPA
  LPLSPEDLESLRSLQRQLLFRQLQKNSGWDTMGSESEGPSA

• Structural information:
  • Protein Domains: (377..53-)
    (/note="SEFIR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00867"-)
  • Interpro: IPR039465  IPR032356  IPR038683  IPR043046  IPR013568  
  • Prosite: PS51534
  • PDB: 3JVF 4HSA 4NUX 5N9B 5NAN
  • PDBsum: 3JVF 4HSA 4NUX 5N9B 5NAN
  • STRING: ENSP00000320936
• Other Databases: GeneCards:  IL17RA  Malacards:  IL17RA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030368	interleukin-17 receptor activity	IBA	molecular function
GO:0030368	interleukin-17 receptor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0097400	interleukin-17-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:2000667	positive regulation of interleukin-13 secretion	IEA	biological process
GO:2000664	positive regulation of interleukin-5 secretion	IEA	biological process
GO:1900017	positive regulation of cytokine production involved in inflammatory response	IEA	biological process
GO:0050832	defense response to fungus	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0071621	granulocyte chemotaxis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0071345	cellular response to cytokine stimulus	IEA	biological process
GO:0032747	positive regulation of interleukin-23 production	IDA	biological process
GO:0072537	fibroblast activation	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007166	cell surface receptor signaling pathway	NAS	biological process
GO:0030368	interleukin-17 receptor activity	NAS	molecular function
GO:0005887	integral component of plasma membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04657	IL-17 signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq