• Gene id: 23761

Gene Summary

• Gene Symbol: PISD   Gene   UCSC   Ensembl
• Aliases: DJ858B16, LIBF, PSD, PSDC, PSSC, dJ858B16.2
• Gene name: phosphatidylserine decarboxylase
• Alternate names: phosphatidylserine decarboxylase proenzyme, mitochondrial,
• Gene location: 22q12.2 (31662563: 31618490)     Exons: 14     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene catalyzes the conversion of phosphatidylserine to phosphatidylethanolamine in the inner mitochondrial membrane. The encoded protein is active in phospholipid metabolism and interorganelle trafficking of phosphatidylserine.
• OMIM: 605461

Protein Summary

• Protein general information: Q9UG56  
  • Name: Phosphatidylserine decarboxylase proenzyme, mitochondrial (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase beta chain; Phosphatidylserine decarboxylase alpha chain]
  • Length: 409  
  • Mass: 46672
• Sequence:

  MATSVGHRCLGLLHGVAPWRSSLHPCEITALSQSLQPLRKLPFRAFRTDARKIHTAPARTMFLLRPLPILLVTGG
  GYAGYRQYEKYRERELEKLGLEIPPKLAGHWEVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVN
  MKEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHSVISPSDGRILNFGQVKNCEVEQVKGVTYSLESFLGPRMCT
  EDLPFPPAASCDSFKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKELFC
  HNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNREGVPMRKGEHLGEFN
  LGSTIVLIFEAPKDFNFQLKTGQKIRFGEALGSL

• Structural information:
  • Interpro: IPR003817  IPR033177  IPR033661  
  • STRING: ENSP00000371586
• Other Databases: GeneCards:  PISD  Malacards:  PISD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004609	phosphatidylserine decarboxylase activity	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0006646	phosphatidylethanolamine biosynthetic process	IBA	biological process
GO:0004609	phosphatidylserine decarboxylase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0016831	carboxy-lyase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004609	phosphatidylserine decarboxylase activity	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0006646	phosphatidylethanolamine biosynthetic process	IEA	biological process
GO:0016540	protein autoprocessing	IEA	biological process
GO:0004609	phosphatidylserine decarboxylase activity	IEA	molecular function
GO:0031305	integral component of mitochondrial inner membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00564	Glycerophospholipid metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq