• Gene id: 23741

Gene Summary

• Gene Symbol: EID1   Gene   UCSC   Ensembl
• Aliases: C15orf3, CRI1, EID-1, IRO45620, PNAS-22, PTD014, RBP21
• Gene name: EP300 interacting inhibitor of differentiation 1
• Alternate names: EP300-interacting inhibitor of differentiation 1, 21 kDa pRb-associated protein, CREBBP/EP300 inhibitor 1, CREBBP/EP300 inhibitory protein 1, E1A-like inhibitor of differentiation 1, NB4 apoptosis related protein, Rb- and p300-binding protein EID-1, retinoblasto,
• Gene location: 15q21.1 (48878133: 48880172)     Exons: 1     NC_000015.10
• OMIM: 605894

Protein Summary

• Protein general information: Q9Y6B2  
  • Name: EP300 interacting inhibitor of differentiation 1 (21 kDa pRb associated protein) (CREBBP/EP300 inhibitory protein 1) (E1A like inhibitor of differentiation 1) (EID 1)
  • Length: 187  
  • Mass: 20876
  • Tissue specificity: Widely expressed. Most abundantly expressed in heart, skeletal muscle, pancreas, brain and testis. Expressed at much lower levels in placenta and peripheral blood leukocyte. Barely detectable in lung. Also weakly expressed in lung carc
• Sequence:

  MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSL
  ANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMH
  YEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE

• Structural information:
  • Interpro: IPR033258  IPR033255  
  • STRING: ENSP00000431162
• Other Databases: GeneCards:  EID1  Malacards:  EID1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IBA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0035065	regulation of histone acetylation	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0045595	regulation of cell differentiation	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IPI	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0035035	histone acetyltransferase binding	IDA	molecular function
GO:0035034	histone acetyltransferase regulator activity	IDA	molecular function
GO:0030154	cell differentiation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003714	transcription corepressor activity	ISS	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)