Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 23710
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol GABARAPL1   Gene   UCSC   Ensembl
Aliases APG8-LIKE, APG8L, ATG8, ATG8B, ATG8L, GEC1
Gene name GABA type A receptor associated protein like 1
Alternate names gamma-aminobutyric acid receptor-associated protein-like 1, GABA(A) receptor-associated protein-like 1, early estrogen-regulated protein, glandular epithelial cell protein 1,
Gene location 12p13.2 (10212876: 10223127)     Exons: 4     NC_000012.12
OMIM 607420

Protein Summary
Protein general information Q9H0R8  

Name: Gamma aminobutyric acid receptor associated protein like 1 (Early estrogen regulated protein) (GABA(A) receptor associated protein like 1) (Glandular epithelial cell protein 1) (GEC 1)

Length: 117  Mass: 14044

Tissue specificity: Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. In the brain, expression is particular

Sequence MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDA
LFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
Structural information
Interpro:  IPR004241  IPR029071  

PDB:  		 2L8J 2R2Q 5DPT 5LXH 5LXI 6HOI 6HOL
PDBsum:   2L8J 2R2Q 5DPT 5LXH 5LXI 6HOI 6HOL

DIP:  
35597
MINT:  
STRING:   ENSP00000266458
Other Databases GeneCards:  GABARAPL1  Malacards:  GABARAPL1

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005739 mitochondrion
 IGI colocalizes with
GO:0005829 cytosol
 IBA cellular component
GO:0006995 cellular response to nitr
ogen starvation
 IBA biological process
GO:0008017 microtubule binding
 IBA molecular function
GO:0031625 ubiquitin protein ligase
binding
 IBA molecular function
GO:0050811 GABA receptor binding
 IBA molecular function
GO:0000045 autophagosome assembly
 IBA biological process
GO:0000421 autophagosome membrane
 IBA cellular component
GO:0000422 autophagy of mitochondrio
n
 IBA biological process
GO:0005776 autophagosome
 IBA cellular component
GO:0016236 macroautophagy
 IBA biological process
GO:0097352 autophagosome maturation
 IBA biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0030957 Tat protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0031410 cytoplasmic vesicle
 IEA cellular component
GO:0006914 autophagy
 IEA biological process
GO:0005874 microtubule
 IEA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005856 cytoskeleton
 IEA cellular component
GO:0005776 autophagosome
 IDA cellular component
GO:0000421 autophagosome membrane
 TAS cellular component
GO:0016236 macroautophagy
 TAS biological process
GO:0097352 autophagosome maturation
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005622 intracellular
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0044297 cell body
 IEA cellular component
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0032839 dendrite cytoplasm
 IEA cellular component
GO:0032590 dendrite membrane
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0030659 cytoplasmic vesicle membr
ane
 IEA cellular component
GO:0005776 autophagosome
 IEA cellular component
GO:0005856 cytoskeleton
 IEA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0048487 beta-tubulin binding
 ISS molecular function
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function
GO:0050811 GABA receptor binding
 ISS molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05131Shigellosis
hsa05167Kaposi sarcoma-associated herpesvirus infection
hsa04621NOD-like receptor signaling pathway
hsa04140Autophagy - animal
hsa04371Apelin signaling pathway
hsa04068FoxO signaling pathway
hsa04727GABAergic synapse
hsa04137Mitophagy - animal
hsa04136Autophagy - other

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract