• Gene id: 23708

Gene Summary

• Gene Symbol: GSPT2   Gene   UCSC   Ensembl
• Aliases: ERF3B, GST2
• Gene name: G1 to S phase transition 2
• Alternate names: eukaryotic peptide chain release factor GTP-binding subunit ERF3B, eukaryotic peptide chain release factor subunit 3b,
• Gene location: Xp11.22 (201619181: 201487420)     Exons: 18     NC_000002.12
• Gene summary(Entrez): This gene encodes a GTPase that belongs to the GTP-binding elongation factor family. The encoded protein is a polypeptide release factor that complexes with eukaryotic peptide chain release factor 1 to mediate translation termination. This protein may als
• OMIM: 300418

Protein Summary

• Protein general information: Q8IYD1  
  • Name: Eukaryotic peptide chain release factor GTP binding subunit ERF3B (Eukaryotic peptide chain release factor subunit 3b) (eRF3b) (G1 to S phase transition protein 2 homolog)
  • Length: 628  
  • Mass: 68883
  • Tissue specificity: Highly expressed in IUCC stage II colorectal cancer (CRC). {ECO
• Sequence:

  MDSGSSSSDSAPDCWDQVDMESPGSAPSGDGVSSAVAEAQREPLSSAFSRKLNVNAKPFVPNVHAAEFVPSFLRG
  PTQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVTMELSEPVVENGEVEMALEESW
  EHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVIVPSGAPKKEHVNVVFIGHVDAGKSTIGGQIMF
  LTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIG
  GASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLK
  KVGFSPKKDIHFMPCSGLTGANIKEQSDFCPWYTGLPFIPYLDNLPNFNRSIDGPIRLPIVDKYKDMGTVVLGKL
  ESGSIFKGQQLVMMPNKHNVEVLGILSDDTETDFVAPGENLKIRLKGIEEEEILPGFILCDPSNLCHSGRTFDVQ
  IVIIEHKSIICPGYNAVLHIHTCIEEVEITALISLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDF
  PQMGRFTLRDEGKTIAIGKVLKLVPEKD

• Structural information:
  • Protein Domains: (201..42-)
    (/note="tr-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01059"-)
  • Interpro: IPR009818  IPR004161  IPR031157  IPR027417  IPR000795   IPR009000  IPR009001  IPR004160  
  • Prosite: PS00301 PS51722
  • PDB: 3KUJ
  • PDBsum: 3KUJ
  • STRING: ENSP00000341247
• Other Databases: GeneCards:  GSPT2  Malacards:  GSPT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002184	cytoplasmic translational termination	IBA	biological process
GO:0003747	translation release factor activity	IBA	molecular function
GO:0003924	GTPase activity	IBA	molecular function
GO:0006412	translation	IBA	biological process
GO:0018444	translation release factor complex	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)