• Gene id: 23704

Gene Summary

• Gene Symbol: KCNE4   Gene   UCSC   Ensembl
• Aliases: MIRP3
• Gene name: potassium voltage-gated channel subfamily E regulatory subunit 4
• Alternate names: potassium voltage-gated channel subfamily E member 4, MINK-related peptide 3, cardiac voltage-gated potassium channel accessory subunit 4, minimum potassium ion channel-related peptide 3, potassium channel subunit beta MiRP3, potassium channel, voltage gated s,
• Gene location: 2q36.1 (223051929: 223055636)     Exons: 2     NC_000002.12
• Gene summary(Entrez): Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro
• OMIM: 607775

Protein Summary

• Protein general information: Q8WWG9  
  • Name: Potassium voltage gated channel subfamily E member 4 (MinK related peptide 3) (Minimum potassium ion channel related peptide 3) (Potassium channel subunit beta MiRP3)
  • Length: 221  
  • Mass: 23806
  • Tissue specificity: Predominantly expressed in embryo and adult uterus. Low expression found in kidney, small intestine, lung and heart. {ECO
• Sequence:

  MHFLTIYPNCSSGVVRAQSRTEQKNPLGLDDLGIQNLGQTVSLAPAVEAASMLKMEPLNSTHPGTAASSSPLESR
  AAGGGSGNGNEYFYILVVMSFYGIFLIGIMLGYMKSKRREKKSSLLLLYKDEERLWGEAMKPLPVVSGLRSVQVP
  LMLNMLQESVAPALSCTLCSMEGDSVSSESSSPDVHLTIQEEGADDELEETSETPLNESSEGSSENIHQNS

• Structural information:
  • Interpro: IPR000369  
  • STRING: ENSP00000281830
• Other Databases: GeneCards:  KCNE4  Malacards:  KCNE4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005251	delayed rectifier potassium channel activity	IBA	contributes to
GO:0044325	ion channel binding	IBA	molecular function
GO:0086005	ventricular cardiac muscle cell action potential	IBA	biological process
GO:0086011	membrane repolarization during action potential	IBA	biological process
GO:0097623	potassium ion export across plasma membrane	IBA	biological process
GO:1902260	negative regulation of delayed rectifier potassium channel activity	IBA	biological process
GO:1902282	voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization	IBA	contributes to
GO:0008076	voltage-gated potassium channel complex	IBA	colocalizes with
GO:0015459	potassium channel regulator activity	IBA	molecular function
GO:0060307	regulation of ventricular cardiac muscle cell membrane repolarization	IBA	biological process
GO:0086091	regulation of heart rate by cardiac conduction	IBA	biological process
GO:0044325	ion channel binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0098915	membrane repolarization during ventricular cardiac muscle cell action potential	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881