• Gene id: 23673

Gene Summary

• Gene Symbol: STX12   Gene   UCSC   Ensembl
• Aliases: STX13, STX14
• Gene name: syntaxin 12
• Alternate names: syntaxin-12,
• Gene location: 1p35.3 (27773218: 27824442)     Exons: 9     NC_000001.11
• OMIM: 606892

Protein Summary

• Protein general information: Q86Y82  
  • Name: Syntaxin 12
  • Length: 276  
  • Mass: 31642
• Sequence:

  MSYGPLDMYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHSTNQLAK
  ETNELLKELGSLPLPLSTSEQRQQRLQKERLMNDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREE
  QLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERETAIRQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVES
  SEVHVERATEQLQRAAYYQKKSRKKMCILVLVLSVIILILGLIIWLVYKTK

• Structural information:
  • Protein Domains: (178..24-)
    homology (/note="t-SNARE-coiled-coil)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00202"-)
  • Interpro: IPR010989  IPR006012  IPR006011  IPR000727  
  • Prosite: PS00914 PS50192
  • CDD: cd00179
  • PDB: 2DNX
  • PDBsum: 2DNX
  • DIP: 44225
  • STRING: ENSP00000363054
• Other Databases: GeneCards:  STX12  Malacards:  STX12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000407	phagophore assembly site	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031982	vesicle	IMP	cellular component
GO:0000045	autophagosome assembly	IMP	biological process
GO:0000149	SNARE binding	IBA	molecular function
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0006886	intracellular protein transport	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0006906	vesicle fusion	IBA	biological process
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0030285	integral component of synaptic vesicle membrane	IBA	cellular component
GO:0031201	SNARE complex	IBA	cellular component
GO:0048278	vesicle docking	IBA	biological process
GO:0098837	postsynaptic recycling endosome	IBA	cellular component
GO:0031201	SNARE complex	IDA	cellular component
GO:0031083	BLOC-1 complex	IDA	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005484	SNAP receptor activity	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033344	cholesterol efflux	IDA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0050821	protein stabilization	IDA	biological process
GO:0045335	phagocytic vesicle	IDA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)