• Gene id: 23659

Gene Summary

• Gene Symbol: PLA2G15   Gene   UCSC   Ensembl
• Aliases: ACS, GXVPLA2, LLPL, LPLA2, LYPLA3
• Gene name: phospholipase A2 group XV
• Alternate names: phospholipase A2 group XV, group XV phospholipase A2, 1-O-acylceramide synthase, LCAT-like lysophospholipase, lysophospholipase 3 (lysosomal phospholipase A2), lysosomal phospholipase A and acyltransferase, lysosomal phospholipase A2,
• Gene location: 16q22.1 (68245370: 68261061)     Exons: 7     NC_000016.10
• Gene summary(Entrez): Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine to glycerophosphorylcholine and a free fatty acid. This enzyme is presen
• OMIM: 609362

Protein Summary

• Protein general information: Q8NCC3  
  • Name: Phospholipase A2 group XV (1 O acylceramide synthase) (ACS) (LCAT like lysophospholipase) (LLPL) (EC 3.1.1.5) (Lysophospholipase 3) (Lysosomal phospholipase A and acyltransferase) (EC 2.3.1. ) (EC 3.1.1.32) (EC 3.1.1.4) (Lysosomal phospholipase A2) (LPLA2
  • Length: 412  
  • Mass: 46658
  • Tissue specificity: Detected in blood plasma (at protein level) (PubMed
• Sequence:

  MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTI
  WLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGY
  TRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVS
  LGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQ
  DIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQ
  SRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP

• Structural information:
  • Interpro: IPR029058  IPR003386  
  • PDB: 4X90 4X91 4X92 4X93 4X94 4X95 4X97 6MTW
  • PDBsum: 4X90 4X91 4X92 4X93 4X94 4X95 4X97 6MTW
  • STRING: ENSP00000219345
• Other Databases: GeneCards:  PLA2G15  Malacards:  PLA2G15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IDA	cellular component
GO:0008374	O-acyltransferase activity	IDA	molecular function
GO:0006672	ceramide metabolic process	IDA	biological process
GO:0006650	glycerophospholipid metabolic process	IDA	biological process
GO:0008374	O-acyltransferase activity	ISS	molecular function
GO:0008970	phospholipase A1 activity	ISS	molecular function
GO:0046338	phosphatidylethanolamine catabolic process	ISS	biological process
GO:0006672	ceramide metabolic process	ISS	biological process
GO:0016411	acylglycerol O-acyltransferase activity	ISS	molecular function
GO:0006651	diacylglycerol biosynthetic process	ISS	biological process
GO:0047499	calcium-independent phospholipase A2 activity	ISS	molecular function
GO:0034638	phosphatidylcholine catabolic process	ISS	biological process
GO:0008374	O-acyltransferase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016042	lipid catabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005543	phospholipid binding	TAS	molecular function
GO:0004622	lysophospholipase activity	TAS	molecular function
GO:0009062	fatty acid catabolic process	TAS	biological process
GO:0008970	phospholipase A1 activity	IEA	molecular function
GO:0004622	lysophospholipase activity	IEA	molecular function
GO:0052739	phosphatidylserine 1-acylhydrolase activity	IEA	molecular function
GO:0102568	phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)	IEA	molecular function
GO:0102567	phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0102545	phosphatidyl phospholipase B activity	IEA	molecular function
GO:0052740	1-acyl-2-lysophosphatidylserine acylhydrolase activity	IEA	molecular function
GO:0047499	calcium-independent phospholipase A2 activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0006644	phospholipid metabolic process	TAS	biological process
GO:0046470	phosphatidylcholine metabolic process	IEA	biological process
GO:0008374	O-acyltransferase activity	IEA	molecular function
GO:0046338	phosphatidylethanolamine catabolic process	IEA	biological process
GO:0008970	phospholipase A1 activity	IEA	molecular function
GO:0008374	O-acyltransferase activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0047499	calcium-independent phospholipase A2 activity	IEA	molecular function
GO:0006672	ceramide metabolic process	IEA	biological process
GO:0047499	calcium-independent phospholipase A2 activity	IEA	molecular function
GO:0034638	phosphatidylcholine catabolic process	IEA	biological process
GO:0016411	acylglycerol O-acyltransferase activity	IEA	molecular function
GO:0006672	ceramide metabolic process	IEA	biological process
GO:0006651	diacylglycerol biosynthetic process	IEA	biological process
GO:0006650	glycerophospholipid metabolic process	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0047499	calcium-independent phospholipase A2 activity	ISS	molecular function
GO:0005764	lysosome	NAS	cellular component
GO:0005764	lysosome	ISS	cellular component
GO:0008374	O-acyltransferase activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04142	Lysosome
hsa00564	Glycerophospholipid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881