• Gene id: 23648

Gene Summary

• Gene Symbol: SSBP3   Gene   UCSC   Ensembl
• Aliases: CSDP, SSDP, SSDP1
• Gene name: single stranded DNA binding protein 3
• Alternate names: single-stranded DNA-binding protein 3, sequence-specific single-stranded-DNA-binding protein,
• Gene location: 1p32.3 (54413478: 54225431)     Exons: 21     NC_000001.11
• OMIM: 607390

Protein Summary

• Protein general information: Q9BWW4  
  • Name: Single stranded DNA binding protein 3 (Sequence specific single stranded DNA binding protein)
  • Length: 388  
  • Mass: 40421
  • Tissue specificity: Highly expressed in all hematopoietic tissues, including spleen, lymph node, peripheral blood, bone marrow, thymus, and fetal liver, with highest expression in thymus and fetal liver. Expression is also high in heart, brain, kidney, an
• Sequence:

  MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPE
  RRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNPSSMMGPHSQP
  FMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMGPMGPGPQNYGSGMRP
  PPNSLGPAMPGINMGPGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPIMPSPADSTNSSDNIYTMINP
  VPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSF
  QNDNYSPSMTMSV

• Structural information:
  • Protein Domains: (16..4-)
    (/note="LisH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00126"-)
  • Interpro: IPR006594  IPR008116  
  • Prosite: PS50896
  • DIP: 48897
  • STRING: ENSP00000360371
• Other Databases: GeneCards:  SSBP3  Malacards:  SSBP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060323	head morphogenesis	IEA	biological process
GO:0048382	mesendoderm development	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0021501	prechordal plate formation	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:2000744	positive regulation of anterior head development	IEA	biological process
GO:0065003	protein-containing complex assembly	IEA	biological process
GO:0060322	head development	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0021547	midbrain-hindbrain boundary initiation	IEA	biological process
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq