• Gene id: 23641

Gene Summary

• Gene Symbol: LDOC1   Gene   UCSC   Ensembl
• Aliases: BCUR1, Mar7, Mart7, RTL7, SIRH7
• Gene name: LDOC1, regulator of NFKB signaling
• Alternate names: protein LDOC1, Sushi-Ichi retrotransposon homolog 7, breast cancer, up-regulated 1, leucine zipper down-regulated in cancer 1, leucine zipper downregulated in cancer, leucine zipper protein down-regulated in cancer cells, mammalian retrotransposon-derived,
• Gene location: Xq27.1 (141177213: 141175744)     Exons: 1     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought t
• OMIM: 300402

Protein Summary

• Protein general information: O95751  
  • Name: Protein LDOC1 (Leucine zipper protein down regulated in cancer cells)
  • Length: 146  
  • Mass: 16,968
• Sequence:

  MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYM
  LVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY

• Structural information:
  • Interpro: IPR032549  IPR032567  
  • STRING: ENSP00000359557
• Other Databases: GeneCards:  LDOC1  Malacards:  LDOC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0008285	negative regulation of cell proliferation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0008285	negative regulation of cell proliferation	IEA	biological process
GO:0008285	negative regulation of cell proliferation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0008285	negative regulation of cell proliferation	TAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 21547351
Male factor infertility	MIK: 21547351
DiGeorge syndrome	INFBASE: 21547351
DiGeorge anomaly	MIK: 21547351
Cryptorchidism	MIK: 21547351
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21547351	DiGeorge anomaly, cryptorchidism				Male infertility	LDOC1 PARP1
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R