Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 23636
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol NUP62   Gene   UCSC   Ensembl
Aliases IBSN, SNDI, p62
Gene name nucleoporin 62
Alternate names nuclear pore glycoprotein p62, 62 kDa nucleoporin, nucleoporin 62kD, nucleoporin 62kDa, nucleoporin Nup62,
Gene location 19q13.33 (49487553: 49492307)     Exons: 8     NC_000019.10
Gene summary(Entrez) The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex i
OMIM 605815

Protein Summary
Protein general information P37198  

Name: Nuclear pore glycoprotein p62 (62 kDa nucleoporin) (Nucleoporin Nup62)

Length: 522  Mass: 53255

Sequence MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLFSLATQTPATQTTGFT
FGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPSTTSVA
PATTSGGFSFTGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTAGATQPAAPTPTATITSTGPSLFASI
ATAPTSSATTGLSLCTPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPA
GIPSNTAAAVTAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITSL
HREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHADEEREKTYKLAENIDAQLKRMAQD
LKDIIEHLNTSGAPADTSDPLQQICKILNAHMDSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD
Structural information
Interpro:  IPR026010  IPR007758  IPR033072  

PDB:  		 2H4D 5IJN 5IJO
PDBsum:   2H4D 5IJN 5IJO

DIP:  
29749
MINT:  
STRING:   ENSP00000471191
Other Databases GeneCards:  NUP62  Malacards:  NUP62

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005543 phospholipid binding
 IBA molecular function
GO:0006606 protein import into nucle
us
 IBA biological process
GO:0006405 RNA export from nucleus
 IBA biological process
GO:0017056 structural constituent of
nuclear pore
 IBA molecular function
GO:0044613 nuclear pore central tran
sport channel
 IBA cellular component
GO:0005635 nuclear envelope
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005643 nuclear pore
 IEA cellular component
GO:0017056 structural constituent of
nuclear pore
 IEA molecular function
GO:0051169 nuclear transport
 IEA biological process
GO:0051028 mRNA transport
 IEA biological process
GO:0005643 nuclear pore
 IEA cellular component
GO:0005856 cytoskeleton
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0016032 viral process
 IEA biological process
GO:0015031 protein transport
 IEA biological process
GO:0015031 protein transport
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0005643 nuclear pore
 TAS cellular component
GO:1990904 ribonucleoprotein complex
 IDA cellular component
GO:0005643 nuclear pore
 IDA cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0005635 nuclear envelope
 TAS cellular component
GO:0006406 mRNA export from nucleus
 TAS biological process
GO:0006406 mRNA export from nucleus
 TAS biological process
GO:0006406 mRNA export from nucleus
 TAS biological process
GO:0006409 tRNA export from nucleus
 TAS biological process
GO:0016032 viral process
 TAS biological process
GO:0016925 protein sumoylation
 TAS biological process
GO:0060964 regulation of gene silenc
ing by miRNA
 TAS biological process
GO:0006110 regulation of glycolytic
process
 TAS biological process
GO:0019083 viral transcription
 TAS biological process
GO:0075733 intracellular transport o
f virus
 TAS biological process
GO:1900034 regulation of cellular re
sponse to heat
 TAS biological process
GO:0005635 nuclear envelope
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0044877 protein-containing comple
x binding
 IEA molecular function
GO:0031965 nuclear membrane
 IEA cellular component
GO:0019894 kinesin binding
 IEA molecular function
GO:0006606 protein import into nucle
us
 IEA biological process
GO:0051879 Hsp90 protein binding
 IEA molecular function
GO:0051425 PTB domain binding
 IEA molecular function
GO:0046580 negative regulation of Ra
s protein signal transduc
tion
 IEA biological process
GO:0043407 negative regulation of MA
P kinase activity
 IEA biological process
GO:0042059 negative regulation of ep
idermal growth factor rec
eptor signaling pathway
 IEA biological process
GO:0031965 nuclear membrane
 IEA cellular component
GO:0030544 Hsp70 protein binding
 IEA molecular function
GO:0042306 regulation of protein imp
ort into nucleus
 IEA biological process
GO:0032991 protein-containing comple
x
 IEA cellular component
GO:0017056 structural constituent of
nuclear pore
 IEA molecular function
GO:0007283 spermatogenesis
 IEA biological process
GO:0005643 nuclear pore
 IEA cellular component
GO:0005642 annulate lamellae
 IEA cellular component
GO:0000278 mitotic cell cycle
 IEA biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IEA biological process
GO:0007569 cell aging
 IEA biological process
GO:0005643 nuclear pore
 IEA cellular component
GO:0005815 microtubule organizing ce
nter
 IEA cellular component
GO:0005635 nuclear envelope
 IEA cellular component
GO:0000922 spindle pole
 IEA cellular component
GO:0005643 nuclear pore
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0031965 nuclear membrane
 IDA cellular component
GO:0043657 host cell
 IEA cellular component
GO:0090543 Flemming body
 IDA cellular component
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0005813 centrosome
 IDA cellular component
GO:0043130 ubiquitin binding
 IDA molecular function
GO:0007166 cell surface receptor sig
naling pathway
 IDA biological process
GO:0042169 SH2 domain binding
 IDA molecular function
GO:0005635 nuclear envelope
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0000922 spindle pole
 IDA cellular component
GO:0072686 mitotic spindle
 IDA cellular component
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
 IDA biological process
GO:0043069 negative regulation of pr
ogrammed cell death
 IDA biological process
GO:0043066 negative regulation of ap
optotic process
 IDA biological process
GO:0030159 signaling receptor comple
x adaptor activity
 IDA molecular function
GO:0008285 negative regulation of ce
ll population proliferati
on
 IDA biological process
GO:0005643 nuclear pore
 IDA cellular component
GO:1904781 positive regulation of pr
otein localization to cen
trosome
 IMP biological process
GO:0046578 regulation of Ras protein
signal transduction
 NAS biological process
GO:0007080 mitotic metaphase plate c
ongression
 IMP biological process
GO:0098534 centriole assembly
 IMP biological process
GO:1903438 positive regulation of mi
totic cytokinetic process
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0009966 regulation of signal tran
sduction
 NAS biological process
GO:0008219 cell death
 IMP biological process
GO:0005737 cytoplasm
 NAS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0007100 mitotic centrosome separa
tion
 IMP biological process
GO:0007098 centrosome cycle
 IMP biological process
GO:0045840 positive regulation of mi
totic nuclear division
 IMP biological process
GO:0003682 chromatin binding
 NAS molecular function
GO:0046601 positive regulation of ce
ntriole replication
 IMP biological process
GO:0045742 positive regulation of ep
idermal growth factor rec
eptor signaling pathway
 NAS biological process
GO:0007166 cell surface receptor sig
naling pathway
 NAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0060236 regulation of mitotic spi
ndle organization
 IMP biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03013RNA transport

Diseases

Expand All | Collapse All
Associated diseases References
Infantile bilateral striatal necrosis KEGG:H01177
Infantile bilateral striatal necrosis KEGG:H01177
Primary biliary cirrhosis PMID:12753810
Cryptorchidism MIK: 28606200
Male factor infertility MIK: 29961538
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
29961538 Male facto
r infertil
ity
318 (128 couple
s presenting wi
th OAT (MF) and
118 maternal a
ge-matched cont
rol (no MF) sub
jects undergoin
g infertility t
reatment, 72 su
rplus cryoprese
rved blastocyst
s)
 Male infertility RNA-seq
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract
31037746 Spermatoge
nic defect
s
16 (1 control,
15 cases)
 Male infertility GSE6023 analyzed using GEO2R
 Show abstract