• Gene id: 23635

Gene Summary

• Gene Symbol: SSBP2   Gene   UCSC   Ensembl
• Aliases: HSPC116, SOSS-B2
• Gene name: single stranded DNA binding protein 2
• Alternate names: single-stranded DNA-binding protein 2, sequence-specific single-stranded-DNA-binding protein 2,
• Gene location: 5q14.1 (70248792: 70209443)     Exons: 18     NC_000002.12
• Gene summary(Entrez): This gene encodes a subunit of a protein complex that interacts with single-stranded DNA and is involved in the DNA damage response and maintenance of genome stability. The encoded protein may also play a role in telomere repair. A variant of this gene ma
• OMIM: 607389

Protein Summary

• Protein general information: P81877  
  • Name: Single stranded DNA binding protein 2 (Sequence specific single stranded DNA binding protein 2)
  • Length: 361  
  • Mass: 37828
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAA
  PERRETCEHSSEAKAFHDYSAAAAPSPVLGNIPPGDGMPVGPVPPGFFQPFMSPRYPGGPRPPLRIPNQALGGVP
  GSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPT
  NANSIPYSSASPGNYVGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPNRPNFPMGPGSDGPMGGLGGM
  ESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQSESYSPSMTMSV

• Structural information:
  • Protein Domains: (18..5-)
    (/note="LisH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00126"-)
  • Interpro: IPR006594  IPR008116  
  • Prosite: PS50896
  • PDB: 6IWV 6TYD
  • PDBsum: 6IWV 6TYD
  • DIP: 29459
  • STRING: ENSP00000483921
• Other Databases: GeneCards:  SSBP2  Malacards:  SSBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0003697	single-stranded DNA binding	NAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray