• Gene id: 23633

Gene Summary

• Gene Symbol: KPNA6   Gene   UCSC   Ensembl
• Aliases: IPOA7
• Gene name: karyopherin subunit alpha 6
• Alternate names: importin subunit alpha-7, importin alpha 7 subunit, importin-alpha-S2, karyopherin alpha 6 (importin alpha 7),
• Gene location: 1p35.2 (64911901: 64958690)     Exons: 15     NC_000015.10
• Gene summary(Entrez): Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a het
• OMIM: 610563

Protein Summary

• Protein general information: O60684  
  • Name: Importin subunit alpha 7 (Karyopherin subunit alpha 6)
  • Length: 536  
  • Mass: 60030
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYVSST
  TGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPRVVDRFVEFLKRNENCTLQFEAAWALT
  NIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLTKSTRLT
  MTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLV
  ELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQAVI
  DANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCDLLTVMDSKIVQVALNGLENILR
  LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQ
  QPEAPMEGFQL

• Structural information:
  • Protein Domains: (1..6-)
    (/note="IBB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00561"-)
  • Interpro: IPR011989  IPR016024  IPR032413  IPR000225  IPR002652   IPR036975  IPR024931  
  • Prosite: PS50176 PS51214
  • PDB: 4UAD
  • PDBsum: 4UAD
  • DIP: 27609
  • STRING: ENSP00000362728
• Other Databases: GeneCards:  KPNA6  Malacards:  KPNA6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IBA	cellular component
GO:0006607	NLS-bearing protein import into nucleus	IBA	biological process
GO:0008139	nuclear localization sequence binding	IBA	molecular function
GO:0061608	nuclear import signal receptor activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0042025	host cell nucleus	IEA	cellular component
GO:0061608	nuclear import signal receptor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006606	protein import into nucleus	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0006607	NLS-bearing protein import into nucleus	TAS	biological process
GO:1903902	positive regulation of viral life cycle	IMP	biological process
GO:0075506	entry of viral genome into host nucleus through nuclear pore complex via importin	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903902	positive regulation of viral life cycle	IEA	biological process
GO:1900017	positive regulation of cytokine production involved in inflammatory response	IEA	biological process
GO:0061608	nuclear import signal receptor activity	IEA	molecular function
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0030682	mitigation of host defenses by symbiont	IEA	biological process
GO:0075506	entry of viral genome into host nucleus through nuclear pore complex via importin	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0019079	viral genome replication	IEA	biological process
GO:0006606	protein import into nucleus	IEA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05164	Influenza A

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray