• Gene id: 23625

Gene Summary

• Gene Symbol: FAM89B   Gene   UCSC   Ensembl
• Aliases: LRAP25, MTVR, MTVR1
• Gene name: family with sequence similarity 89 member B
• Alternate names: leucine repeat adapter protein 25, leucine repeat adaptor protein 25, mammary tumor virus receptor homolog 1, protein FAM89B,
• Gene location: 11q13.1 (65572537: 65574189)     Exons: 2     NC_000011.10
• OMIM: 616128

Protein Summary

• Protein general information: Q8N5H3  
  • Name: Leucine repeat adapter protein 25
  • Length: 189  
  • Mass: 20147
• Sequence:

  MNGLPSAEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAGAANAG
  PAAGPRRPVNLDSALAALRKEMVGLRQLDMSLLCQLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGL
  SDDEEPPDASLPPDPPPLTVPQTHNARDQWLQDAFHISL

• Structural information:
  • Interpro: IPR039499  
  • STRING: ENSP00000431459
• Other Databases: GeneCards:  FAM89B  Malacards:  FAM89B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030010	establishment of cell polarity	IBA	biological process
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0060392	negative regulation of SMAD protein signal transduction	IBA	biological process
GO:0001222	transcription corepressor binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0030027	lamellipodium	IBA	cellular component
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IBA	biological process
GO:0060392	negative regulation of SMAD protein signal transduction	ISS	biological process
GO:0030335	positive regulation of cell migration	ISS	biological process
GO:0030010	establishment of cell polarity	ISS	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0001222	transcription corepressor binding	ISS	molecular function
GO:0030027	lamellipodium	ISS	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0060392	negative regulation of SMAD protein signal transduction	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0030010	establishment of cell polarity	IEA	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001222	transcription corepressor binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881