• Gene id: 23620

Gene Summary

• Gene Symbol: NTSR2   Gene   UCSC   Ensembl
• Aliases: NTR2
• Gene name: neurotensin receptor 2
• Alternate names: neurotensin receptor type 2, NT-R-2, levocabastine-sensitive neurotensin receptor, neurotensin receptor, type 2,
• Gene location: 2p25.1 (11670205: 11658118)     Exons: 4     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the G protein-coupled receptor family that activate a phosphatidylinositol-calcium second messenger system. Binding and pharmacological studies demonstrate that this receptor binds neurotensin as well as several
• OMIM: 606938

Protein Summary

• Protein general information: O95665  
  • Name: Neurotensin receptor type 2 (NT R 2) (NTR2) (Levocabastine sensitive neurotensin receptor)
  • Length: 410  
  • Mass: 45385
  • Tissue specificity: Expressed in prostate (at protein level). {ECO
• Sequence:

  METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKARAGRAGRLRHHVLSL
  ALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAYATVLSVAGLSAERCLAVCQPLRARSLLTPR
  RTRWLVALSWAASLGLALPMAVIMGQKHELETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFL
  NGVTVSHLLALCSQVPSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLR
  AIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNAVSSSFRKLFLEAVSS
  LCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR003986  IPR003984  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000303686
• Other Databases: GeneCards:  NTSR2  Malacards:  NTSR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016492	G protein-coupled neurotensin receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007600	sensory perception	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016492	G protein-coupled neurotensin receptor activity	IEA	molecular function
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0042391	regulation of membrane potential	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881