• Gene id: 23613

Gene Summary

• Gene Symbol: ZMYND8   Gene   UCSC   Ensembl
• Aliases: PRKCBP1, PRO2893, RACK7
• Gene name: zinc finger MYND-type containing 8
• Alternate names: protein kinase C-binding protein 1, CTCL tumor antigen se14-3, cutaneous T-cell lymphoma-associated antigen se14-3, predicted protein of HQ2893, zinc finger MYND domain-containing protein 8,
• Gene location: 20q13.12 (47356888: 47209213)     Exons: 29     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a receptor for activated C-kinase (RACK) protein. The encoded protein has been shown to bind in vitro to activated protein kinase C beta I. In addition, this protein is a cutaneous T-cell lymphoma-associated antigen. Fi
• OMIM: 604874

Protein Summary

• Protein general information: Q9ULU4  
  • Name: Protein kinase C binding protein 1 (Cutaneous T cell lymphoma associated antigen se14 3) (CTCL associated antigen se14 3) (Rack7) (Zinc finger MYND domain containing protein 8)
  • Length: 1186  
  • Mass: 131692
  • Tissue specificity: Expressed in all tissues examined with highest expression in brain, lung, pancreas, and placenta. Expressed in cutaneous T-cell lymphomas (CTCL).
• Sequence:

  MDISTRSKDPGSAERTAQKRKFPSPPHSSNGHSPQDTSTSPIKKKKKPGLLNSNNKEQSELRHGPFYYMKQPLTT
  DPVDVVPQDGRNDFYCWVCHREGQVLCCELCPRVYHAKCLRLTSEPEGDWFCPECEKITVAECIETQSKAMTMLT
  IEQLSYLLKFAIQKMKQPGTDAFQKPVPLEQHPDYAEYIFHPMDLCTLEKNAKKKMYGCTEAFLADAKWILHNCI
  IYNGGNHKLTQIAKVVIKICEHEMNEIEVCPECYLAACQKRDNWFCEPCSNPHPLVWAKLKGFPFWPAKALRDKD
  GQVDARFFGQHDRAWVPINNCYLMSKEIPFSVKKTKSIFNSAMQEMEVYVENIRRKFGVFNYSPFRTPYTPNSQY
  QMLLDPTNPSAGTAKIDKQEKVKLNFDMTASPKILMSKPVLSGGTGRRISLSDMPRSPMSTNSSVHTGSDVEQDA
  EKKATSSHFSASEESMDFLDKSTASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKA
  EMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVYTAVEHSDSEDSEKSDSSDS
  EYISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDF
  SEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPST
  TVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKF
  QTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSG
  SMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQ
  QELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPC
  QQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSG
  SRETPSSILLGSNQGSDHSRSNKSSWSSSDEKRGSTRSDHNTSTSTKSLLPKESRLDTFWD

• Structural information:
  • Protein Domains: (165..23-)
    (/note="Bromo-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00035-)
    (277..32-)
    (/note="PWWP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00162"-)
  • Interpro: IPR001487  IPR036427  IPR000313  IPR037967  IPR019786   IPR021931  IPR035505  IPR011011  IPR002893  IPR001965  IPR019787  IPR013083  
  • Prosite: PS50014 PS50812 PS01360 PS50865 PS01359 PS50016
  • CDD: cd05508 cd05841
  • PDB: 4COS 5B73 5MQ4 5Y1Z
  • PDBsum: 4COS 5B73 5MQ4 5Y1Z
  • STRING: ENSP00000420095
• Other Databases: GeneCards:  ZMYND8  Malacards:  ZMYND8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035064	methylated histone binding	IDA	molecular function
GO:0070577	lysine-acetylated histone binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0003714	transcription corepressor activity	IMP	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902897	regulation of postsynaptic density protein 95 clustering	IEA	biological process
GO:0060999	positive regulation of dendritic spine development	IEA	biological process
GO:0051491	positive regulation of filopodium assembly	IEA	biological process
GO:1902952	positive regulation of dendritic spine maintenance	IEA	biological process
GO:0098815	modulation of excitatory postsynaptic potential	IEA	biological process
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0043198	dendritic shaft	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003714	transcription corepressor activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070491	repressing transcription factor binding	ISS	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0008270	zinc ion binding	IDA	molecular function
GO:0019904	protein domain specific binding	IDA	molecular function
GO:0005737	cytoplasm	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881