About Us

Search Result


Gene id 23612
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol PHLDA3   Gene   UCSC   Ensembl
Aliases TIH1
Gene name pleckstrin homology like domain family A member 3
Alternate names pleckstrin homology-like domain family A member 3, TDAG51/Ipl homolog 1, pleckstrin homology-like domain, family A, member 2,
Gene location 1q32.1 (201469187: 201464277)     Exons: 3     NC_000001.11
OMIM 613419

Protein Summary

Protein general information Q9Y5J5  

Name: Pleckstrin homology like domain family A member 3 (TDAG51/Ipl homolog 1)

Length: 127  Mass: 13891

Tissue specificity: Widely expressed with lowest expression in liver and spleen. {ECO

Sequence MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTL
VTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS
Structural information
Protein Domains
(8..12-)
(/note="PH"-)
Interpro:  IPR011993  IPR001849  IPR042832  IPR040443  
STRING:   ENSP00000356280
Other Databases GeneCards:  PHLDA3  Malacards:  PHLDA3

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0042771 intrinsic apoptotic signa
ling pathway in response
to DNA damage by p53 clas
s mediator
IBA biological process
GO:0051898 negative regulation of pr
otein kinase B signaling
IBA biological process
GO:0043065 positive regulation of ap
optotic process
IBA biological process
GO:0005886 plasma membrane
IBA cellular component
GO:1901981 phosphatidylinositol phos
phate binding
IEA molecular function
GO:0043065 positive regulation of ap
optotic process
IEA biological process
GO:0005737 cytoplasm
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0006915 apoptotic process
IEA biological process
GO:0009653 anatomical structure morp
hogenesis
TAS biological process
GO:0016020 membrane
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0042771 intrinsic apoptotic signa
ling pathway in response
to DNA damage by p53 clas
s mediator
IDA biological process
GO:0010314 phosphatidylinositol-5-ph
osphate binding
IDA molecular function
GO:0043325 phosphatidylinositol-3,4-
bisphosphate binding
IDA molecular function
GO:0043065 positive regulation of ap
optotic process
IDA biological process
GO:0005886 plasma membrane
IDA cellular component
GO:0005547 phosphatidylinositol-3,4,
5-trisphosphate binding
IDA molecular function
GO:0005546 phosphatidylinositol-4,5-
bisphosphate binding
IDA molecular function
GO:0080025 phosphatidylinositol-3,5-
bisphosphate binding
IDA molecular function
GO:0051898 negative regulation of pr
otein kinase B signaling
IDA biological process
GO:0032266 phosphatidylinositol-3-ph
osphate binding
IDA molecular function
Associated diseases References
Hypospermatogenesis MIK: 28361989

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28361989 Hyposperma
togenesis

6 (3 controls,
3 Klienfelter s
yndrome
Male infertility Microarray
Show abstract