• Gene id: 23609

Gene Summary

• Gene Symbol: MKRN2   Gene   UCSC   Ensembl
• Aliases: HSPC070, RNF62
• Gene name: makorin ring finger protein 2
• Alternate names: probable E3 ubiquitin-protein ligase makorin-2, RING finger protein 62, RING-type E3 ubiquitin transferase makorin-2, makorin RING zinc-finger protein 2,
• Gene location: 3p25.2 (12557013: 12583712)     Exons: 8     NC_000003.12
• Gene summary(Entrez): This gene encodes a probable E3 ubiquitin ligase containing several zinc finger domains, that is a member of the makorin RING zinc-finger protein family. This gene overlaps the v-raf-1 murine leukemia viral oncogene homolog 1 (RAF1) gene in an antisense o
• OMIM: 608426

Protein Summary

• Protein general information: Q9H000  
  • Name: Probable E3 ubiquitin protein ligase makorin 2 (EC 2.3.2.27) (RING finger protein 62) (RING type E3 ubiquitin transferase makorin 2)
  • Length: 416  
  • Mass: 46940
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPS
  PAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDA
  IRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEME
  KAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIP
  SVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNS
  VRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP

• Structural information:
  • Interpro: IPR026293  IPR041367  IPR018957  IPR000571  IPR036855   IPR001841  IPR013083  IPR017907  
  • Prosite: PS50103 PS00518 PS50089
  • STRING: ENSP00000170447
• Other Databases: GeneCards:  MKRN2  Malacards:  MKRN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermiogenesis defects	MIK: 28008940
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28008940	Spermiogenesis defects				Male infertility