• Gene id: 23608

Gene Summary

• Gene Symbol: MKRN1   Gene   UCSC   Ensembl
• Aliases: RNF61
• Gene name: makorin ring finger protein 1
• Alternate names: E3 ubiquitin-protein ligase makorin-1, RING finger protein 61, RING-type E3 ubiquitin transferase makorin-1,
• Gene location: 7q34 (140479568: 140453032)     Exons: 11     NC_000007.14
• Gene summary(Entrez): This gene encodes a protein that belongs to a novel class of zinc finger proteins. The encoded protein functions as a transcriptional co-regulator, and as an E3 ubiquitin ligase that promotes the ubiquitination and proteasomal degradation of target protei
• OMIM: 607754

Protein Summary

• Protein general information: Q9UHC7  
  • Name: E3 ubiquitin protein ligase makorin 1 (EC 2.3.2.27) (RING finger protein 61) (RING type E3 ubiquitin transferase makorin 1)
  • Length: 482  
  • Mass: 53349
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAEAATPGTTATTSGAGAAAATAAAASPTPIPTVTAPSLGAGGGGGGSDGSGGGWTKQVTCRYFMHGVCKEGDNC
  RYSHDLSDSPYSVVCKYFQRGYCIYGDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE
  SRNSNFATVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEAPLQGSVTKEESEKEQTAVETKKQLCPYAAVGECRYG
  ENCVYLHGDSCDMCGLQVLHPMDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFG
  ILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLILKYKEAMSNKACRYFDE
  GRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFWELIEERENSNPFDNDEEEVVTFELGEMLLM
  LLAAGGDDELTDSEDEWDLFHDELEDFYDLDL

• Structural information:
  • Interpro: IPR031644  IPR041367  IPR018957  IPR000571  IPR036855   IPR001841  IPR013083  IPR017907  
  • Prosite: PS50103 PS00518 PS50089
  • STRING: ENSP00000255977
• Other Databases: GeneCards:  MKRN1  Malacards:  MKRN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray