• Gene id: 23604

Gene Summary

• Gene Symbol: DAPK2   Gene   UCSC   Ensembl
• Aliases: DRP-1, DRP1
• Gene name: death associated protein kinase 2
• Alternate names: death-associated protein kinase 2, DAP kinase 2, DAP-kinase-related protein 1 beta isoform,
• Gene location: 15q22.31 (64046484: 63907035)     Exons: 18     NC_000015.10
• Gene summary(Entrez): This gene encodes a protein that belongs to the serine/threonine protein kinase family. This protein contains a N-terminal protein kinase domain followed by a conserved calmodulin-binding domain with significant similarity to that of death-associated prot
• OMIM: 609380

Protein Summary

• Protein general information: Q9UIK4  
  • Name: Death associated protein kinase 2 (DAP kinase 2) (EC 2.7.11.1) (DAP kinase related protein 1) (DRP 1)
  • Length: 370  
  • Mass: 42898
  • Tissue specificity: Expressed in neutrophils and eosinophils (PubMed
• Sequence:

  MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREV
  SILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDL
  KPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGAS
  PFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDNQQAMVRRESV
  VNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRPDEDLRNCESDTEEDIARRKALHPRRRSSTS

• Structural information:
  • Protein Domains: (23..28-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 1WMK 1WRZ 1Z9X 1ZUZ 1ZWS 2A27 2A2A 2CKE
  • PDBsum: 1WMK 1WRZ 1Z9X 1ZUZ 1ZWS 2A27 2A2A 2CKE
  • STRING: ENSP00000261891
• Other Databases: GeneCards:  DAPK2  Malacards:  DAPK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0046777	protein autophosphorylation	TAS	biological process
GO:0043276	anoikis	IMP	biological process
GO:0010506	regulation of autophagy	TAS	biological process
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:2000424	positive regulation of eosinophil chemotaxis	IMP	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034423	autophagosome lumen	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005516	calmodulin binding	IDA	molecular function
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005524	ATP binding	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:2001242	regulation of intrinsic apoptotic signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04140	Autophagy - animal
hsa05219	Bladder cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq