• Gene id: 23603

Gene Summary

• Gene Symbol: CORO1C   Gene   UCSC   Ensembl
• Aliases: HCRNN4
• Gene name: coronin 1C
• Alternate names: coronin-1C, coronin, actin binding protein, 1C, coronin-3,
• Gene location: 12q24.11 (74952911: 74946582)     Exons: 2     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
• OMIM: 605269

Protein Summary

• Protein general information: Q9ULV4  
  • Name: Coronin 1C (Coronin 3) (hCRNN4)
  • Length: 474  
  • Mass: 53249
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPT
  VCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAG
  CDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAI
  FLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESP
  YVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAE
  EWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKS
  IKDTICNQDERISKLEQQMAKIAA

• Structural information:
  • Interpro: IPR027333  IPR015505  IPR015048  IPR015943  IPR001680   IPR019775  IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • DIP: 33138
  • STRING: ENSP00000394496
• Other Databases: GeneCards:  CORO1C  Malacards:  CORO1C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001755	neural crest cell migration	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0016477	cell migration	IBA	biological process
GO:0007015	actin filament organization	IBA	biological process
GO:0090148	membrane fission	IDA	biological process
GO:0140285	endosome fission	IDA	biological process
GO:0016197	endosomal transport	IDA	biological process
GO:0097750	endosome membrane tubulation	IDA	biological process
GO:0010008	endosome membrane	IDA	cellular component
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0051015	actin filament binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006909	phagocytosis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900027	regulation of ruffle assembly	IEA	biological process
GO:0090630	activation of GTPase activity	IEA	biological process
GO:0016600	flotillin complex	IEA	cellular component
GO:0048365	Rac GTPase binding	IEA	molecular function
GO:0045184	establishment of protein localization	IEA	biological process
GO:0022038	corpus callosum development	IEA	biological process
GO:0021591	ventricular system development	IEA	biological process
GO:0010762	regulation of fibroblast migration	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0032587	ruffle membrane	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0030017	sarcomere	IEA	cellular component
GO:0042383	sarcolemma	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0016328	lateral plasma membrane	IDA	cellular component
GO:0005925	focal adhesion	IDA	NOT|colocalizes with
GO:0030027	lamellipodium	IDA	cellular component
GO:0031982	vesicle	IDA	colocalizes with
GO:0005925	focal adhesion	HDA	cellular component
GO:0051895	negative regulation of focal adhesion assembly	IMP	biological process
GO:1900024	regulation of substrate adhesion-dependent cell spreading	IGI	biological process
GO:0090630	activation of GTPase activity	ISS	biological process
GO:0051015	actin filament binding	IMP	molecular function
GO:0010632	regulation of epithelial cell migration	IGI	biological process
GO:0010633	negative regulation of epithelial cell migration	IMP	biological process
GO:0045184	establishment of protein localization	ISS	biological process
GO:0001755	neural crest cell migration	IMP	biological process
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	IMP	biological process
GO:0044387	negative regulation of protein kinase activity by regulation of protein phosphorylation	IMP	biological process
GO:0001933	negative regulation of protein phosphorylation	IMP	biological process
GO:2000394	positive regulation of lamellipodium morphogenesis	IMP	biological process
GO:0016600	flotillin complex	ISS	cellular component
GO:0001932	regulation of protein phosphorylation	IGI	biological process
GO:0051893	regulation of focal adhesion assembly	IGI	biological process
GO:0010762	regulation of fibroblast migration	ISS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq