• Gene id: 23596

Gene Summary

• Gene Symbol: OPN3   Gene   UCSC   Ensembl
• Aliases: ECPN, PPP1R116
• Gene name: opsin 3
• Alternate names: opsin-3, encephalopsin, opsin 3 (encephalopsin, panopsin), protein phosphatase 1, regulatory subunit 116,
• Gene location: 1q43 (241640368: 241593123)     Exons: 4     NC_000001.11
• Gene summary(Entrez): Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. In addition to the visual opsins, mammals possess several photoreceptive non-visual opsins that are expressed in extraocular tissues. This gene, opsin 3
• OMIM: 609411

Protein Summary

• Protein general information: Q9H1Y3  
  • Name: Opsin 3 (Encephalopsin) (Panopsin)
  • Length: 402  
  • Mass: 44873
  • Tissue specificity: Strongly expressed in brain. Highly expressed in the preoptic area and paraventricular nucleus of the hypothalamus. Shows highly patterned expression in other regions of the brain, being enriched in selected regions of the cerebral cor
• Sequence:

  MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTP
  THLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVIN
  FSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHI
  LYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKS
  NTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFII
  TSDESLSVDDSDKTNGSKVDVIQVRPL

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR027430  
  • Prosite: PS00237 PS50262 PS00238
  • STRING: ENSP00000355512
• Other Databases: GeneCards:  OPN3  Malacards:  OPN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001750	photoreceptor outer segment	IBA	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007602	phototransduction	IBA	biological process
GO:0008020	G protein-coupled photoreceptor activity	IBA	molecular function
GO:0071482	cellular response to light stimulus	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0009881	photoreceptor activity	IEA	molecular function
GO:0018298	protein-chromophore linkage	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007602	phototransduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0009584	detection of visible light	IEA	biological process
GO:0009584	detection of visible light	IEA	biological process
GO:0042752	regulation of circadian rhythm	NAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0009583	detection of light stimulus	NAS	biological process
GO:0008020	G protein-coupled photoreceptor activity	NAS	molecular function
GO:0007602	phototransduction	NAS	biological process
GO:0009881	photoreceptor activity	NAS	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray