• Gene id: 23595

Gene Summary

• Gene Symbol: ORC3   Gene   UCSC   Ensembl
• Aliases: LAT, LATHEO, ORC3L
• Gene name: origin recognition complex subunit 3
• Alternate names: origin recognition complex subunit 3, homolog of latheo, Drosophila, origin recognition complex subunit Latheo, origin recognition complex, subunit 3 honolog,
• Gene location: 6q15 (23879747: 23875933)     Exons: 3     NC_000020.11
• Gene summary(Entrez): The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves
• OMIM: 604972

Protein Summary

• Protein general information: Q9UBD5  
  • Name: Origin recognition complex subunit 3 (Origin recognition complex subunit Latheo)
  • Length: 711  
  • Mass: 82254
• Sequence:

  MATSSMSKGCFVFKPNSKKRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQMKSENERLQEELNKNLFDNLIE
  FLQKSHSGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGSLTEALQNNVTPYVVSLQAKDCPDMKHFLQK
  LISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKDMESF
  ATKVLQDFIIISSQHLHEFPLILIFGIATSPIIIHRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPF
  KINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCCNLPEAKRRINFLSNNQCENIRRLPSFRRY
  VEKQASEKQVALLTNERYLKEETQLLLENLHVYHMNYFLVLRCLHKFTSSLPKYPLGRQIRELYCTCLEKNIWDS
  EEYASVLQLLRMLAKDELMTILEKCFKVFKSYCENHLGSTAKRIEEFLAQFQSLDETKEEEDASGSQPKGLQKTD
  LYHLQKSLLEMKELRRSKKQTKFEVLRENVVNFIDCLVREYLLPPETQPLHEVVYFSAAHALREHLNAAPRIALH
  TALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAEKMDANSATSEEMNEI
  IHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC

• Structural information:
  • Interpro: IPR020795  IPR040855  
  • PDB: 5UJ8 5UJM
  • PDBsum: 5UJ8 5UJM
  • DIP: 31735
  • STRING: ENSP00000257789
• Other Databases: GeneCards:  ORC3  Malacards:  ORC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003688	DNA replication origin binding	IBA	molecular function
GO:0005656	nuclear pre-replicative complex	IBA	cellular component
GO:0005664	nuclear origin of replication recognition complex	IBA	cellular component
GO:0006267	pre-replicative complex assembly involved in nuclear cell cycle DNA replication	IBA	biological process
GO:0006270	DNA replication initiation	IBA	biological process
GO:0031261	DNA replication preinitiation complex	IBA	cellular component
GO:0005664	nuclear origin of replication recognition complex	IDA	cellular component
GO:0005664	nuclear origin of replication recognition complex	IDA	cellular component
GO:0000808	origin recognition complex	IDA	cellular component
GO:0006275	regulation of DNA replication	IDA	biological process
GO:0000785	chromatin	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005664	nuclear origin of replication recognition complex	IEA	cellular component
GO:0006260	DNA replication	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003688	DNA replication origin binding	TAS	molecular function
GO:0006260	DNA replication	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061351	neural precursor cell proliferation	IEA	biological process
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881