• Gene id: 2359

Gene Summary

• Gene Symbol: FPR3   Gene   UCSC   Ensembl
• Aliases: FML2_HUMAN, FMLP-R-II, FMLPY, FPRH1, FPRH2, FPRL2, RMLP-R-I
• Gene name: formyl peptide receptor 3
• Alternate names: N-formyl peptide receptor 3, FMLP-related receptor II, formyl peptide receptor-like 2,
• Gene location: 19q13.41 (51795156: 51826206)     Exons: 20     NC_000019.10
• OMIM: 136539

SNPs

rs2057951

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.31334059A>G
NC_000022.10   g.31730045A>G|SEQ=[A/G]|GENE=PATZ1
PIK3IP1-DT   101929760

Protein Summary

• Protein general information: P25089  
  • Name: N formyl peptide receptor 3 (FMLP related receptor II) (FMLP R II) (Formyl peptide receptor like 2)
  • Length: 353  
  • Mass: 39965
• Sequence:

  METNFSIPLNETEEVLPEPAGHTVLWIFSLLVHGVTFVFGVLGNGLVIWVAGFRMTRTVNTICYLNLALADFSFS
  AILPFRMVSVAMREKWPFGSFLCKLVHVMIDINLFVSVYLITIIALDRCICVLHPAWAQNHRTMSLAKRVMTGLW
  IFTIVLTLPNFIFWTTISTTNGDTYCIFNFAFWGDTAVERLNVFITMAKVFLILHFIIGFSVPMSIITVCYGIIA
  AKIHRNHMIKSSRPLRVFAAVVASFFICWFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPI
  LYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETELQAM

• Structural information:
  • Interpro: IPR027347  IPR000826  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000341821
• Other Databases: GeneCards:  FPR3  Malacards:  FPR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004875	complement receptor activity	IBA	molecular function
GO:0002430	complement receptor mediated signaling pathway	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0004982	N-formyl peptide receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004982	N-formyl peptide receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004982	N-formyl peptide receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa05150	Staphylococcus aureus infection

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq