• Gene id: 23589

Gene Summary

• Gene Symbol: CARHSP1   Gene   UCSC   Ensembl
• Aliases: CRHSP-24, CRHSP24, CSDC1
• Gene name: calcium regulated heat stable protein 1
• Alternate names: calcium-regulated heat-stable protein 1, calcium regulated heat stable protein 1, 24kDa, calcium-regulated heat-stable protein (24kD), calcium-regulated heat-stable protein of 24 kDa,
• Gene location: 16p13.2 (8869011: 8852941)     Exons: 12     NC_000016.10
• OMIM: 616885

Protein Summary

• Protein general information: Q9Y2V2  
  • Name: Calcium regulated heat stable protein 1 (Calcium regulated heat stable protein of 24 kDa) (CRHSP 24)
  • Length: 147  
  • Mass: 15892
• Sequence:

  MSSEPPPPPQPPTHQASVGLLDTPRSRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKG
  HGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWSGHVISS

• Structural information:
  • Protein Domains: (62..12-)
    (/note="CSD"-)
  • Interpro: IPR011129  IPR019844  IPR002059  IPR012340  
  • Prosite: PS00352 PS51857
  • CDD: cd04458
  • PDB: 3AQQ
  • PDBsum: 3AQQ
  • STRING: ENSP00000379838
• Other Databases: GeneCards:  CARHSP1  Malacards:  CARHSP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0043488	regulation of mRNA stability	IBA	biological process
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0043488	regulation of mRNA stability	ISS	biological process
GO:0043186	P granule	ISS	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0000177	cytoplasmic exosome (RNase complex)	ISS	colocalizes with
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043488	regulation of mRNA stability	IEA	biological process
GO:0043186	P granule	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0000177	cytoplasmic exosome (RNase complex)	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0019902	phosphatase binding	NAS	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R