• Gene id: 23585

Gene Summary

• Gene Symbol: TMEM50A   Gene   UCSC   Ensembl
• Aliases: IFNRC, SMP1
• Gene name: transmembrane protein 50A
• Alternate names: transmembrane protein 50A, cervical cancer oncogene 9, small membrane protein 1,
• Gene location: 1p36.11 (25338333: 25362360)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene is located in the RH gene locus, between the RHD and RHCE genes. The function of its protein product is unknown; however, its sequence has potential transmembrane domains suggesting that it may be an integral membrane protein. Its position betwe
• OMIM: 605348

Protein Summary

• Protein general information: O95807  
  • Name: Transmembrane protein 50A (Small membrane protein 1)
  • Length: 157  
  • Mass: 17400
• Sequence:

  MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSYHACGVIATIAFLMINAVSN
  GQVRGDSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYVAKEKDIVYPGIAVFFQNAFIFFGGLVFKFG
  RTEDLWQ

• Structural information:
  • Interpro: IPR007919  
  • STRING: ENSP00000363478
• Other Databases: GeneCards:  TMEM50A  Malacards:  TMEM50A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032511	late endosome to vacuole transport via multivesicular body sorting pathway	IBA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097386	glial cell projection	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)