• Gene id: 2358

Gene Summary

• Gene Symbol: FPR2   Gene   UCSC   Ensembl
• Aliases: ALXR, FMLP-R-II, FMLPX, FPR2A, FPRH1, FPRH2, FPRL1, HM63, LXA4R
• Gene name: formyl peptide receptor 2
• Alternate names: N-formyl peptide receptor 2, FMLP-R-I, FMLP-related receptor I, LXA4 receptor, RFP, formyl peptide receptor-like 1, lipoxin A4 receptor (formyl peptide receptor related),
• Gene location: 19q13.41 (51752025: 51770530)     Exons: 5     NC_000019.10

Protein Summary

• Protein general information: P25090  
  • Name: N formyl peptide receptor 2 (FMLP related receptor I) (FMLP R I) (Formyl peptide receptor like 1) (HM63) (Lipoxin A4 receptor) (LXA4 receptor) (RFP)
  • Length: 351  
  • Mass: 38964
  • Tissue specificity: Expressed abundantly in the lung and neutrophils. Also found in the spleen and testis. {ECO
• Sequence:

  METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFT
  ATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPW
  ILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIA
  AKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
  LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM

• Structural information:
  • Interpro: IPR027347  IPR000826  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000468897
• Other Databases: GeneCards:  FPR2  Malacards:  FPR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007166	cell surface receptor signaling pathway	IDA	biological process
GO:0002768	immune response-regulating cell surface receptor signaling pathway	IDA	biological process
GO:1904646	cellular response to amyloid-beta	IDA	biological process
GO:0045089	positive regulation of innate immune response	IDA	biological process
GO:0042742	defense response to bacterium	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0038023	signaling receptor activity	IDA	molecular function
GO:0001540	amyloid-beta binding	ISS	molecular function
GO:0001540	amyloid-beta binding	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	NAS	molecular function
GO:0004930	G protein-coupled receptor activity	NAS	molecular function
GO:0005124	scavenger receptor binding	IPI	molecular function
GO:0038024	cargo receptor activity	ISS	molecular function
GO:0061903	positive regulation of 1-phosphatidylinositol-3-kinase activity	ISS	biological process
GO:0050728	negative regulation of inflammatory response	IDA	biological process
GO:0050766	positive regulation of phagocytosis	IDA	biological process
GO:1904646	cellular response to amyloid-beta	ISS	biological process
GO:1904646	cellular response to amyloid-beta	ISS	biological process
GO:0006898	receptor-mediated endocytosis	ISS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IGI	biological process
GO:0007186	G protein-coupled receptor signaling pathway	NAS	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IGI	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IGI	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0019722	calcium-mediated signaling	IGI	biological process
GO:0001934	positive regulation of protein phosphorylation	IGI	biological process
GO:0048143	astrocyte activation	ISS	biological process
GO:0001774	microglial cell activation	ISS	biological process
GO:0032930	positive regulation of superoxide anion generation	ISS	biological process
GO:0050918	positive chemotaxis	ISS	biological process
GO:0090026	positive regulation of monocyte chemotaxis	IGI	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0004982	N-formyl peptide receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004875	complement receptor activity	IBA	molecular function
GO:0002430	complement receptor mediated signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004982	N-formyl peptide receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0004982	N-formyl peptide receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa05150	Staphylococcus aureus infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray