• Gene id: 2357

Gene Summary

• Gene Symbol: FPR1   Gene   UCSC   Ensembl
• Aliases: FMLP, FPR
• Gene name: formyl peptide receptor 1
• Alternate names: fMet-Leu-Phe receptor, N-formylpeptide chemoattractant receptor, fMLP receptor,
• Gene location: 19q13.41 (51751896: 51745769)     Exons: 3     NC_000019.10
• Gene summary(Entrez): This gene encodes a G protein-coupled receptor of mammalian phagocytic cells that is a member of the G-protein coupled receptor 1 family. The protein mediates the response of phagocytic cells to invasion of the host by microorganisms and is important in h
• OMIM: 136537

Protein Summary

• Protein general information: P21462  
  • Name: fMet Leu Phe receptor (fMLP receptor) (N formyl peptide receptor) (FPR) (N formylpeptide chemoattractant receptor)
  • Length: 350  
  • Mass: 38,446
• Sequence:

  METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFT
  STLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPW
  VMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIA
  TKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
  YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK

• Structural information:
  • Interpro: IPR027345  IPR000826  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000302707
• Other Databases: GeneCards:  FPR1  Malacards:  FPR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0004872	receptor activity	TAS	molecular function
GO:0004982	N-formyl peptide receptor activity	IDA	molecular function
GO:0004982	N-formyl peptide receptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005768	endosome	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	TAS	biological process
GO:0007188	adenylate cyclase-modulating G-protein coupled receptor signaling pathway	TAS	biological process
GO:0007200	phospholipase C-activating G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007263	nitric oxide mediated signal transduction	TAS	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050786	RAGE receptor binding	IEA	molecular function
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0004871	signal transducer activity	IEA	molecular function
GO:0004872	receptor activity	TAS	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004982	N-formyl peptide receptor activity	IEA	molecular function
GO:0004982	N-formyl peptide receptor activity	IEA	molecular function
GO:0004982	N-formyl peptide receptor activity	TAS	molecular function
GO:0004982	N-formyl peptide receptor activity	IDA	molecular function
GO:0004982	N-formyl peptide receptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005768	endosome	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	TAS	biological process
GO:0007188	adenylate cyclase-modulating G-protein coupled receptor signaling pathway	TAS	biological process
GO:0007200	phospholipase C-activating G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007200	phospholipase C-activating G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007263	nitric oxide mediated signal transduction	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0050786	RAGE receptor binding	IEA	molecular function
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0004872	receptor activity	TAS	molecular function
GO:0004982	N-formyl peptide receptor activity	TAS	molecular function
GO:0004982	N-formyl peptide receptor activity	IDA	molecular function
GO:0004982	N-formyl peptide receptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005768	endosome	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	TAS	biological process
GO:0007188	adenylate cyclase-modulating G-protein coupled receptor signaling pathway	TAS	biological process
GO:0007200	phospholipase C-activating G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007263	nitric oxide mediated signal transduction	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa05150	Staphylococcus aureus infection

Diseases

Associated diseases	References
Aggressive periodontitis	GAD: 19254133
Inflammation	GAD: 16953235
Periodontitis	GAD: 20019777
Endometriosis	INFBASE: 25201101
Female infertility	INFBASE: 25201101
Unexplained infertility	MIK: 24597237
Male factor infertility	MIK: 24597237
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 24597237

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24597237	Unexplained infertility			20 normozoospermic infertile men	Male infertility	CD52 CD69 CD98 fMLP HI307 and 80280
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881