• Gene id: 23569

Gene Summary

• Gene Symbol: PADI4   Gene   UCSC   Ensembl
• Aliases: PAD, PAD4, PADI5, PDI4, PDI5
• Gene name: peptidyl arginine deiminase 4
• Alternate names: protein-arginine deiminase type-4, HL-60 PAD, PADI-H protein, peptidyl arginine deiminase, type IV, peptidyl arginine deiminase, type V, protein-arginine deiminase type IV,
• Gene location: 1p36.13 (17308194: 17364003)     Exons: 18     NC_000001.11
• Gene summary(Entrez): This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. [prov
• OMIM: 614587

Protein Summary

• Protein general information: Q9UM07  
  • Name: Protein arginine deiminase type 4 (EC 3.5.3.15) (HL 60 PAD) (Peptidylarginine deiminase IV) (Protein arginine deiminase type IV)
  • Length: 663  
  • Mass: 74079
  • Tissue specificity: Expressed in eosinophils and neutrophils, not expressed in peripheral monocytes or lymphocytes. {ECO
• Sequence:

  MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHGPPAKKKSTGSSTWPLDPGVE
  VTLTMKVASGSTGDQKVQISYYGPKTPPVKALLYLTGVEISLCADITRTGKVKPTRAVKDQRTWTWGPCGQGAIL
  LVNCDRDNLESSAMDCEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLVLHVARSEMDKVRVFQATRGKLSSKC
  SVVLGPKWPSHYLMVPGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELPEAVVFQDSVVFRVAPWIMTP
  NTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQDEMEIGYIQAPHKTLPVVFDSPRNRG
  LKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDF
  LSAQQVQAPVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQK
  IKNILSNKTLREHNSFVERCIDWNRELLKRELGLAESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPK
  PFGPVINGRCCLEEKVCSLLEPLGLQCTFINDFFTYHIRHGEVHCGTNVRRKPFSFKWWNMVP

• Structural information:
  • Interpro: IPR008972  IPR004303  IPR013530  IPR036556  IPR013732   IPR038685  IPR013733  
  • PDB: 1WD8 1WD9 1WDA 2DEW 2DEX 2DEY 2DW5 3APM 3APN 3B1T 3B1U 4DKT 4X8C 4X8G 5N0M 5N0Y 5N0Z 5N1B
  • PDBsum: 1WD8 1WD9 1WDA 2DEW 2DEX 2DEY 2DW5 3APM 3APN 3B1T 3B1U 4DKT 4X8C 4X8G 5N0M 5N0Y 5N0Z 5N1B
  • DIP: 50397
  • STRING: ENSP00000364597
• Other Databases: GeneCards:  PADI4  Malacards:  PADI4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004668	protein-arginine deiminase activity	IBA	molecular function
GO:0036414	histone citrullination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0036414	histone citrullination	IDA	biological process
GO:0036414	histone citrullination	IDA	biological process
GO:0036413	histone H3-R26 citrullination	IDA	biological process
GO:0036413	histone H3-R26 citrullination	IDA	biological process
GO:0005509	calcium ion binding	IDA	molecular function
GO:0004668	protein-arginine deiminase activity	IDA	molecular function
GO:0004668	protein-arginine deiminase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0006325	chromatin organization	ISS	biological process
GO:0006334	nucleosome assembly	ISS	biological process
GO:0019827	stem cell population maintenance	ISS	biological process
GO:0006338	chromatin remodeling	ISS	biological process
GO:0004668	protein-arginine deiminase activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0018101	protein citrullination	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004668	protein-arginine deiminase activity	TAS	molecular function
GO:0006464	cellular protein modification process	TAS	biological process
GO:0004668	protein-arginine deiminase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006325	chromatin organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0018101	protein citrullination	IEA	biological process
GO:0004668	protein-arginine deiminase activity	IEA	molecular function
GO:0036414	histone citrullination	IEA	biological process
GO:0006334	nucleosome assembly	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0004668	protein-arginine deiminase activity	IEA	molecular function
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0006338	chromatin remodeling	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0032991	protein-containing complex	IMP	cellular component
GO:0004668	protein-arginine deiminase activity	IMP	molecular function
GO:0005509	calcium ion binding	IMP	molecular function
GO:0018101	protein citrullination	IMP	biological process
GO:0034618	arginine binding	IMP	molecular function
GO:0018101	protein citrullination	IDA	biological process
GO:0004668	protein-arginine deiminase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray