• Gene id: 23567

Gene Summary

• Gene Symbol: ZNF346   Gene   UCSC   Ensembl
• Aliases: JAZ, Zfp346
• Gene name: zinc finger protein 346
• Alternate names: zinc finger protein 346, double-stranded RNA-binding zinc finger protein JAZ, just another zinc finger protein,
• Gene location: 5q35.2 (177022679: 177081188)     Exons: 13     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a nucleolar, zinc finger protein that preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids, rather than DNA alone. Mutational studies indicate that the zinc finger domains are not only essential for dsRNA
• OMIM: 607418

Protein Summary

• Protein general information: Q9UL40  
  • Name: Zinc finger protein 346 (Just another zinc finger protein)
  • Length: 294  
  • Mass: 32933
• Sequence:

  MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVEHMIQKNQCLFTNTQC
  KVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKLDSDQKSSRSKDKNQCCPICNMTFSSPVVAQ
  SHYLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRL
  ADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLGQIPMQRQPIQKDSTTLED

• Structural information:
  • Interpro: IPR003604  IPR036236  IPR013087  
  • PDB: 2MKD 2MKN
  • PDBsum: 2MKD 2MKN
  • STRING: ENSP00000350869
• Other Databases: GeneCards:  ZNF346  Malacards:  ZNF346

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003725	double-stranded RNA binding	IBA	molecular function
GO:0035198	miRNA binding	IDA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray