• Gene id: 23563

Gene Summary

• Gene Symbol: CHST5   Gene   UCSC   Ensembl
• Aliases: I-GlcNAc-6-ST, I-GlcNAc6ST, glcNAc6ST-3, gn6st-3, hIGn6ST
• Gene name: carbohydrate sulfotransferase 5
• Alternate names: carbohydrate sulfotransferase 5, GST4-alpha, N-acetylglucosamine 6-O-sulfotransferase 3, carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5, galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-alpha, intestinal GlcNAc-6-sulfotransfe,
• Gene location: 16q23.1 (75536107: 75528529)     Exons: 4     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the Gal/GalNAc/GlcNAc 6-O-sulfotransferase (GST) family, members of which catalyze the transfer of sulfate to position 6 of galactose (Gal), N-acetylgalactosamine (GalNAc), or N-acetylglucosamine (GlcNAc) residu
• OMIM: 617368

Protein Summary

• Protein general information: Q9GZS9  
  • Name: Carbohydrate sulfotransferase 5 (EC 2.8.2. ) (Galactose/N acetylglucosamine/N acetylglucosamine 6 O sulfotransferase 4 alpha) (GST4 alpha) (Intestinal N acetylglucosamine 6 O sulfotransferase) (I GlcNAc6ST) (Intestinal GlcNAc 6 sulfotransferase) (hIGn6ST)
  • Length: 411  
  • Mass: 46161
  • Tissue specificity: Predominantly expressed in small and large intestines and colon. Weakly expressed in lymphocytes. Not expressed in other tissues. Down-regulated in colonic adenocarcinomas. {ECO
• Sequence:

  MGMRARVPKVAHSTRRPPAARMWLPRFSSKTVTVLLLAQTTCLLLFIISRPGPSSPAGGEDRVHVLVLSSWRSGS
  SFLGQLFSQHPDVFYLMEPAWHVWTTLSQGSAATLHMAVRDLMRSIFLCDMDVFDAYMPQSRNLSAFFNWATSRA
  LCSPPACSAFPRGTISKQDVCKTLCTRQPFSLAREACRSYSHVVLKEVRFFNLQVLYPLLSDPALNLRIVHLVRD
  PRAVLRSREAAGPILARDNGIVLGTNGKWVEADPHLRLIREVCRSHVRIAEAATLKPPPFLRGRYRLVRFEDLAR
  EPLAEIRALYAFTGLTLTPQLEAWIHNITHGSGIGKPIEAFHTSSRNARNVSQAWRHALPFTKILRVQEVCAGAL
  QLLGYRPVYSADQQRDLTLDLVLPRGPDHFSWASPD

• Structural information:
  • Interpro: IPR016469  IPR027417  IPR000863  
  • STRING: ENSP00000338783
• Other Databases: GeneCards:  CHST5  Malacards:  CHST5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006790	sulfur compound metabolic process	IBA	biological process
GO:0001517	N-acetylglucosamine 6-O-sulfotransferase activity	IBA	molecular function
GO:0018146	keratan sulfate biosynthetic process	IBA	biological process
GO:0006044	N-acetylglucosamine metabolic process	IBA	biological process
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0006477	protein sulfation	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0018146	keratan sulfate biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0006044	N-acetylglucosamine metabolic process	IDA	biological process
GO:0006044	N-acetylglucosamine metabolic process	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006790	sulfur compound metabolic process	IDA	biological process
GO:0001517	N-acetylglucosamine 6-O-sulfotransferase activity	IDA	molecular function
GO:0031228	intrinsic component of Golgi membrane	NAS	cellular component
GO:0016021	integral component of membrane	NAS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq