• Gene id: 23560

Gene Summary

• Gene Symbol: GTPBP4   Gene   UCSC   Ensembl
• Aliases: CRFG, NGB, NOG1
• Gene name: GTP binding protein 4
• Alternate names: nucleolar GTP-binding protein 1, G protein-binding protein CRFG, GTP-binding protein NGB, chronic renal failure gene protein,
• Gene location: 10p15.3 (988433: 1019931)     Exons: 17     NC_000010.11
• Gene summary(Entrez): GTP-binding proteins are GTPases and function as molecular switches that can flip between two states: active, when GTP is bound, and inactive, when GDP is bound. 'Active' in this context usually means that the molecule acts as a signal to trigger other ev

Protein Summary

• Protein general information: Q9BZE4  
  • Name: Nucleolar GTP binding protein 1 (Chronic renal failure gene protein) (GTP binding protein NGB)
  • Length: 634  
  • Mass: 73964
• Sequence:

  MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILTDFPKLDDI
  HPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTVIKRQKQSLEY
  LEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGI
  LDHPLEDRNTIEMQAITALAHLRAAVLYVMDLSEQCGHGLREQLELFQNIRPLFINKPLIVVANKCDVKRIAELS
  EDDQKIFTDLQSEGFPVIETSTLTEEGVIKVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAIPTRRDDKERPP
  FIPEGVVARRKRMETEESRKKRERDLELEMGDDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIADYIDPAIMKKL
  EELEKEEELRTAAGEYDSVSESEDEEMLEIRQLAKQIREKKKLKILESKEKNTQGPRMPRTAKKVQRTVLEKEMR
  SLGVDMDDKDDAHYAVQARRSRSITRKRKREDSAPPSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKM
  NRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR

• Structural information:
  • Protein Domains: (169..34-)
    (/note="OBG-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01047"-)
  • Interpro: IPR031167  IPR006073  IPR024926  IPR041623  IPR010674   IPR012973  IPR027417  IPR005225  
  • Prosite: PS51710
  • STRING: ENSP00000354040
• Other Databases: GeneCards:  GTPBP4  Malacards:  GTPBP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008156	negative regulation of DNA replication	IMP	biological process
GO:0003924	GTPase activity	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0050821	protein stabilization	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030336	negative regulation of cell migration	IDA	biological process
GO:0022408	negative regulation of cell-cell adhesion	IDA	biological process
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	biological process
GO:0033342	negative regulation of collagen binding	IMP	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0001649	osteoblast differentiation	HDA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)