• Gene id: 2356

Gene Summary

• Gene Symbol: FPGS   Gene   UCSC   Ensembl
• Gene name: folylpolyglutamate synthase
• Alternate names: folylpolyglutamate synthase, mitochondrial, folylpoly-gamma-glutamate synthetase, tetrahydrofolate synthase, tetrahydrofolylpolyglutamate synthase,
• Gene location: 9q34.11 (127802857: 127814519)     Exons: 17     NC_000009.12
• Gene summary(Entrez): This gene encodes the folylpolyglutamate synthetase enzyme. This enzyme has a central role in establishing and maintaining both cytosolic and mitochondrial folylpolyglutamate concentrations and, therefore, is essential for folate homeostasis and the survi
• OMIM: 305360

Protein Summary

• Protein general information: Q05932  
  • Name: Folylpolyglutamate synthase, mitochondrial (EC 6.3.2.17) (Folylpoly gamma glutamate synthetase) (FPGS) (Tetrahydrofolylpolyglutamate synthase) (Tetrahydrofolate synthase)
  • Length: 587  
  • Mass: 64609
• Sequence:

  MSRARSHLRAALFLAAASARGITTQVAARRGLSAWPVPQEPSMEYQDAVRMLNTLQTNAGYLEQVKRQRGDPQTQ
  LEAMELYLARSGLQVEDLDRLNIIHVTGTKGKGSTCAFTECILRSYGLKTGFFSSPHLVQVRERIRINGQPISPE
  LFTKYFWRLYHRLEETKDGSCVSMPPYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAYDCTNIIRKPVVCGVSSLG
  IDHTSLLGDTVEKIAWQKGGIFKQGVPAFTVLQPEGPLAVLRDRAQQISCPLYLCPMLEALEEGGPPLTLGLEGE
  HQRSNAALALQLAHCWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEWPGRTQVLRRGPLTWY
  LDGAHTASSAQACVRWFRQALQGRERPSGGPEVRVLLFNATGDRDPAALLKLLQPCQFDYAVFCPNLTEVSSTGN
  ADQQNFTVTLDQVLLRCLEHQQHWNHLDEEQASPDLWSAPSPEPGGSASLLLAPHPPHTCSASSLVFSCISHALQ
  WISQGRDPIFQPPSPPKGLLTHPVAHSGASILREAAAIHVLVTGSLHLVGGVLKLLEPALSQ

• Structural information:
  • Interpro: IPR001645  IPR018109  IPR023600  IPR036565  IPR036615  
  • Prosite: PS01011 PS01012
  • STRING: ENSP00000362344
• Other Databases: GeneCards:  FPGS  Malacards:  FPGS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0004326	tetrahydrofolylpolyglutamate synthase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0009396	folic acid-containing compound biosynthetic process	IBA	biological process
GO:0046901	tetrahydrofolylpolyglutamate biosynthetic process	IBA	biological process
GO:0004326	tetrahydrofolylpolyglutamate synthase activity	IEA	molecular function
GO:0009058	biosynthetic process	IEA	biological process
GO:0009396	folic acid-containing compound biosynthetic process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0006730	one-carbon metabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0004326	tetrahydrofolylpolyglutamate synthase activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0006139	nucleobase-containing compound metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0004326	tetrahydrofolylpolyglutamate synthase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0004326	tetrahydrofolylpolyglutamate synthase activity	TAS	molecular function
GO:0004326	tetrahydrofolylpolyglutamate synthase activity	TAS	molecular function
GO:0004326	tetrahydrofolylpolyglutamate synthase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0046655	folic acid metabolic process	TAS	biological process
GO:0004326	tetrahydrofolylpolyglutamate synthase activity	IEA	molecular function
GO:0001889	liver development	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0031100	animal organ regeneration	IEA	biological process
GO:0004326	tetrahydrofolylpolyglutamate synthase activity	IDA	molecular function
GO:0046901	tetrahydrofolylpolyglutamate biosynthetic process	IDA	biological process
GO:0006760	folic acid-containing compound metabolic process	IDA	biological process
GO:0006536	glutamate metabolic process	IDA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0046901	tetrahydrofolylpolyglutamate biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00790	Folate biosynthesis
hsa01523	Antifolate resistance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881