• Gene id: 23558

Gene Summary

• Gene Symbol: WBP2   Gene   UCSC   Ensembl
• Aliases: DFNB107, GRAMD6, WBP-2
• Gene name: WW domain binding protein 2
• Alternate names: WW domain-binding protein 2,
• Gene location: 17q25.1 (75856435: 75845698)     Exons: 9     NC_000017.11
• Gene summary(Entrez): The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding
• OMIM: 604817

Protein Summary

• Protein general information: Q969T9  
  • Name: WW domain binding protein 2 (WBP 2)
  • Length: 261  
  • Mass: 28087
  • Tissue specificity: Ubiquitous.
• Sequence:

  MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFY
  LMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRGEVPSGAYGYSYMPS
  GAYVYPPPVANGMYPCPPGYPYPPPPPEFYPGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPDVPSTPAAEAKAAE
  AAASAYYNPGNPHNVYMPTSQPPPPPYYPPEDKKTQ

• Structural information:
  • Protein Domains: (1..8-)
    (/note="GRAM"-)
  • Interpro: IPR004182  IPR033598  
  • DIP: 42509
  • STRING: ENSP00000467579
• Other Databases: GeneCards:  WBP2  Malacards:  WBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0031490	chromatin DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0043627	response to estrogen	IDA	biological process
GO:0032570	response to progesterone	IDA	biological process
GO:0033148	positive regulation of intracellular estrogen receptor signaling pathway	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0050847	progesterone receptor signaling pathway	IDA	biological process
GO:0030331	estrogen receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045815	positive regulation of gene expression, epigenetic	IEA	biological process
GO:0000790	nuclear chromatin	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0071391	cellular response to estrogen stimulus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0045184	establishment of protein localization	IMP	biological process
GO:0031490	chromatin DNA binding	IMP	molecular function
GO:0003713	transcription coactivator activity	IMP	molecular function
GO:0071442	positive regulation of histone H3-K14 acetylation	IMP	biological process
GO:0045815	positive regulation of gene expression, epigenetic	IMP	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	molecular function
GO:0071391	cellular response to estrogen stimulus	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process

Diseases

Associated diseases	References
Deafness, autosomal recessive	KEGG:H00605
Deafness, autosomal recessive	KEGG:H00605
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq