• Gene id: 23555

Gene Summary

• Gene Symbol: TSPAN15   Gene   UCSC   Ensembl
• Aliases: 2700063A19Rik, NET-7, NET7, TM4SF15
• Gene name: tetraspanin 15
• Alternate names: tetraspanin-15, tetraspan NET-7, transmembrane 4 superfamily member 15, transmembrane 4 superfamily member tetraspan NET-7, tspan-15,
• Gene location: 10q22.1 (69451463: 69549507)     Exons: 14     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate
• OMIM: 613140

Protein Summary

• Protein general information: O95858  
  • Name: Tetraspanin 15 (Tspan 15) (Tetraspan NET 7) (Transmembrane 4 superfamily member 15)
  • Length: 294  
  • Mass: 33165
• Sequence:

  MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGALVLSVGIYAEVERQKYKTLESAFLAPAIILILLGVVMFM
  VSFIGVLASLRDNLYLLQAFMYILGICLIMELIGGVVALTFRNQTIDFLNDNIRRGIENYYDDLDFKNIMDFVQK
  KFKCCGGEDYRDWSKNQYHDCSAPGPLACGVPYTCCIRNTTEVVNTMCGYKTIDKERFSVQDVIYVRGCTNAVII
  WFMDNYTIMAGILLGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGCCLCYPN

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR008952  
  • STRING: ENSP00000362387
• Other Databases: GeneCards:  TSPAN15  Malacards:  TSPAN15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051604	protein maturation	IBA	biological process
GO:0072659	protein localization to plasma membrane	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051604	protein maturation	IEA	biological process
GO:0097197	tetraspanin-enriched microdomain	IEA	cellular component
GO:0019899	enzyme binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0045746	negative regulation of Notch signaling pathway	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0051604	protein maturation	IMP	biological process
GO:0008593	regulation of Notch signaling pathway	IMP	NOT|biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq