• Gene id: 23547

Gene Summary

• Gene Symbol: LILRA4   Gene   UCSC   Ensembl
• Aliases: CD85g, ILT7
• Gene name: leukocyte immunoglobulin like receptor A4
• Alternate names: leukocyte immunoglobulin-like receptor subfamily A member 4, CD85 antigen-like family member G, immunoglobulin-like transcript 7, leucocyte Ig-like receptor A4, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4, leukocyte immunoglo,
• Gene location: 19q13.42 (54339161: 54333184)     Exons: 8     NC_000019.10
• Gene summary(Entrez): This gene encodes an immunoglobulin-like cell surface protein that is expressed predominantly on plasmacytoid dendritic cells (PDCs) and modulates the function of these cells in the immune response. Expression of this gene is downregulated by interleukin
• OMIM: 607517

Protein Summary

• Protein general information: P59901  
  • Name: Leukocyte immunoglobulin like receptor subfamily A member 4 (CD85 antigen like family member G) (Immunoglobulin like transcript 7) (ILT 7) (CD antigen CD85g)
  • Length: 499  
  • Mass: 55165
  • Tissue specificity: Detected on plasmacytoid dendritic cells (at protein level). Detected on plasmacytoid dendritic cells, but not on monocytes or B cells. {ECO
• Sequence:

  MTLILTSLLFFGLSLGPRTRVQAENLPKPILWAEPGPVITWHNPVTIWCQGTLEAQGYRLDKEGNSMSRHILKTL
  ESENKVKLSIPSMMWEHAGRYHCYYQSPAGWSEPSDPLELVVTAYSRPTLSALPSPVVTSGVNVTLRCASRLGLG
  RFTLIEEGDHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSDPLQLLVSGVSRKPS
  LLTLQGPVVTPGENLTLQCGSDVGYIRYTLYKEGADGLPQRPGRQPQAGLSQANFTLSPVSRSYGGQYRCYGAHN
  VSSEWSAPSDPLDILIAGQISDRPSLSVQPGPTVTSGEKVTLLCQSWDPMFTFLLTKEGAAHPPLRLRSMYGAHK
  YQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSHPSEPLELVVSGATETLNPAQKKSDSKTAPHLQDYTVENLIRM
  GVAGLVLLFLGILLFEAQHSQRSPPRCSQEANSRKDNAPFRVVEPWEQI

• Structural information:
  • Protein Domains: (24..11-)
    1 (/note="Ig-like-C2-type)
    (123..21-)
    2 (/note="Ig-like-C2-type)
    (224..31-)
    3 (/note="Ig-like-C2-type)
    (324..41-)
    4" (/note="Ig-like-C2-type)
  • Interpro: IPR016332  IPR007110  IPR036179  IPR013783  IPR003599   IPR003598  IPR013151  
  • Prosite: PS50835
  • STRING: ENSP00000291759
• Other Databases: GeneCards:  LILRA4  Malacards:  LILRA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032998	Fc-epsilon receptor I complex	IDA	cellular component
GO:0015026	coreceptor activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0032720	negative regulation of tumor necrosis factor production	IMP	biological process
GO:0032687	negative regulation of interferon-alpha production	IMP	biological process
GO:0034164	negative regulation of toll-like receptor 9 signaling pathway	IMP	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0034156	negative regulation of toll-like receptor 7 signaling pathway	IMP	biological process
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04380	Osteoclast differentiation
hsa04662	B cell receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881