• Gene id: 23546

Gene Summary

• Gene Symbol: SYNGR4   Gene   UCSC   Ensembl
• Gene name: synaptogyrin 4
• Alternate names: synaptogyrin-4, testis tissue sperm-binding protein Li 72n,
• Gene location: 19q13.33 (48364266: 48376376)     Exons: 8     NC_000019.10
• Gene summary(Entrez): This gene encodes an integral membrane protein. The gene belongs to the synaptogyrin gene family. Like other members of the family the protein contains four transmembrane regions. The exact function of this protein is unclear. [provided by RefSeq, Jul 200
• OMIM: 606962

Protein Summary

• Protein general information: O95473  
  • Name: Synaptogyrin 4
  • Length: 234  
  • Mass: 25820
• Sequence:

  MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKMESPQLHCILNSNSVACSFAVGAGFL
  AFLSCLAFLVLDTQETRIAGTRFKTAFQLLDFILAVLWAVVWFMGFCFLANQWQHSPPKEFLLGSSSAQAAIAFT
  FFSILVWIFQAYLAFQDLRNDAPVPYKRFLDEGGMVLTTLPLPSANSPVNMPTTGPNSLSYASSALSPCLTAPKS
  PRLAMMPDN

• Structural information:
  • Protein Domains: (18..16-)
    (/note="MARVEL-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00581"-)
  • Interpro: IPR008253  IPR016579  
  • Prosite: PS51225
  • STRING: ENSP00000344041
• Other Databases: GeneCards:  SYNGR4  Malacards:  SYNGR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031594	neuromuscular junction	IBA	cellular component
GO:0030672	synaptic vesicle membrane	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq