• Gene id: 23542

Gene Summary

• Gene Symbol: MAPK8IP2   Gene   UCSC   Ensembl
• Aliases: IB-2, IB2, JIP2, PRKM8IPL
• Gene name: mitogen-activated protein kinase 8 interacting protein 2
• Alternate names: C-Jun-amino-terminal kinase-interacting protein 2, JNK MAP kinase scaffold protein 2, JNK MAP kinase scaffold protein JIP2, JNK-interacting protein 2, homologous to mouse JIP-1, islet-brain 2,
• Gene location: 22q13.33 (50600792: 50613977)     Exons: 12     NC_000022.11
• Gene summary(Entrez): This gene encodes a scaffold protein that is thought to be involved in the regulation of the c-Jun amino-terminal kinase signaling pathway. This protein has been shown to interact with and regulate the activity of MAPK8/JNK1 and MAP2K7/MKK7 kinases. [prov
• OMIM: 608373

Protein Summary

• Protein general information: Q13387  
  • Name: C Jun amino terminal kinase interacting protein 2 (JIP 2) (JNK interacting protein 2) (Islet brain 2) (IB 2) (JNK MAP kinase scaffold protein 2) (Mitogen activated protein kinase 8 interacting protein 2)
  • Length: 824  
  • Mass: 87975
  • Tissue specificity: Expressed mainly in the brain and pancreas, including insulin-secreting cells. In the nervous system, more abundantly expressed in the cerebellum, pituitary gland, occipital lobe and the amygdala. Also expressed in fetal brain. Very lo
• Sequence:

  MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSLSLGRSEQPHPICSFQ
  DDFQEFEMIDDNEEEDDEDEEEEEEEEEGDGEGQEGGDPGSEAPAPGPLIPSPSVEEPHKHRPTTLRLTTLGAQD
  SLNNNGGFDLVRPASWQETALCSPAPEALRELPGPLPATDTGPGGAQSPVRPGCDCEGNRPAEPPAPGGTSPSSD
  PGIEADLRSRSSGGRGGRRSSQELSSPGSDSEDAGGARLGRMISSISETELELSSDGGSSSSGRSSHLTNSIEEA
  SSPASEPEPPREPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWLLSNLVSRMISEGSSPIRCPGQCLSP
  APRPPGEPVSPAGGAAQDSQDPEAAAGPGGVELVDMETLCAPPPPAPAAPRPGPAQPGPCLFLSNPTRDTITPLW
  AAPGRAARPGRACSAACSEEEDEEDDEEEEDAEDSAGSPGGRGTGPSAPRDASLVYDAVKYTLVVDEHTQLELVS
  LRRCAGLGHDSEEDSGGEASEEEAGAALLGGGQVSGDTSPDSPDLTFSKKFLNVFVNSTSRSSSTESFGLFSCLV
  NGEEREQTHRAVFRFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRTGERGVFPAFYAHAVPGPAKDLLGSKR
  SPCWVERFDVQFLGSVEVPCHQGNGILCAAMQKIATARKLTVHLRPPASCDLEISLRGVKLSLSGGGPEFQRCSH
  FFQMKNISFCGCHPRNSCYFGFITKHPLLSRFACHVFVSQESMRPVAQSVGRAFLEYYQEHLAYACPTEDIYLE

• Structural information:
  • Protein Domains: (604..66-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (677..81-)
    (/note="PID-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00148"-)
  • Interpro: IPR035637  IPR011993  IPR006020  IPR001452  
  • Prosite: PS01179 PS50002
  • CDD: cd11942
  • STRING: ENSP00000330572
• Other Databases: GeneCards:  MAPK8IP2  Malacards:  MAPK8IP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0045807	positive regulation of endocytosis	IBA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0006898	receptor-mediated endocytosis	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005198	structural molecule activity	TAS	molecular function
GO:0007172	signal complex assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032874	positive regulation of stress-activated MAPK cascade	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0001662	behavioral fear response	IEA	biological process
GO:0007254	JNK cascade	IEA	biological process
GO:0007617	mating behavior	IEA	biological process
GO:0010469	regulation of signaling receptor activity	IEA	biological process
GO:0035176	social behavior	IEA	biological process
GO:0046958	nonassociative learning	IEA	biological process
GO:0048813	dendrite morphogenesis	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0019894	kinesin binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0051966	regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:2000310	regulation of NMDA receptor activity	IEA	biological process
GO:2000311	regulation of AMPA receptor activity	IEA	biological process
GO:0001662	behavioral fear response	ISS	biological process
GO:0010469	regulation of signaling receptor activity	ISS	biological process
GO:0035176	social behavior	ISS	biological process
GO:0046958	nonassociative learning	ISS	biological process
GO:0048813	dendrite morphogenesis	ISS	biological process
GO:0051966	regulation of synaptic transmission, glutamatergic	ISS	biological process
GO:0060079	excitatory postsynaptic potential	ISS	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:2000310	regulation of NMDA receptor activity	ISS	biological process
GO:2000311	regulation of AMPA receptor activity	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:2001234	negative regulation of apoptotic signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0046328	regulation of JNK cascade	IDA	biological process
GO:0005078	MAP-kinase scaffold activity	IDA	molecular function
GO:0005078	MAP-kinase scaffold activity	NAS	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019894	kinesin binding	ISS	molecular function
GO:0001540	amyloid-beta binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq