• Gene id: 23531

Gene Summary

• Gene Symbol: MMD   Gene   UCSC   Ensembl
• Aliases: MMA, MMD1, PAQR11
• Gene name: monocyte to macrophage differentiation associated
• Alternate names: monocyte to macrophage differentiation factor, macrophage maturation-associated, monocyte to macrophage differentiation protein, progestin and adipoQ receptor family member 11, progestin and adipoQ receptor family member XI,
• Gene location: 17q22 (55421885: 55392616)     Exons: 9     NC_000017.11
• Gene summary(Entrez): This protein is expressed by in vitro differentiated macrophages but not freshly isolated monocytes. Although sequence analysis identifies seven potential transmembrane domains, this protein has little homology to G-protein receptors and it has not been p
• OMIM: 604467

Protein Summary

• Protein general information: Q15546  
  • Name: Monocyte to macrophage differentiation factor (Progestin and adipoQ receptor family member 11) (Progestin and adipoQ receptor family member XI)
  • Length: 238  
  • Mass: 27667
  • Tissue specificity: Exhibits relatively ubiquitous expression with preferential expression in mature (in vitro differentiated) macrophages. {ECO
• Sequence:

  MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLCALFIV
  STVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHEKY
  KVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWK
  YLYRSPTDFMRHL

• Structural information:
  • Interpro: IPR004254  IPR005744  
  • STRING: ENSP00000262065
• Other Databases: GeneCards:  MMD  Malacards:  MMD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0045666	positive regulation of neuron differentiation	IDA	biological process
GO:0032880	regulation of protein localization	IDA	biological process
GO:0045860	positive regulation of protein kinase activity	IDA	biological process
GO:0019835	cytolysis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)