• Gene id: 2353

Gene Summary

• Gene Symbol: FOS   Gene   UCSC   Ensembl
• Aliases: AP-1, C-FOS, p55
• Gene name: Fos proto-oncogene, AP-1 transcription factor subunit
• Alternate names: proto-oncogene c-Fos, FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS), FBJ murine osteosarcoma viral oncogene homolog, Fos proto-oncogene, AP-1 trancription factor subunit, G0/G1 switch regulatory protein 7, activator protein 1, cellular o,
• Gene location: 14q24.3 (75278827: 75282229)     Exons: 4     NC_000014.9
• Gene summary(Entrez): The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have b
• OMIM: 617736

SNPs

rs886039789

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.43615851C>G
NC_000005.10   g.43615851C>T
NC_000005.9   g.43615953C>G
NC_000005.9   g.43615953C>T
NG_032869.1   g.18163C>G
NG_032869.1   g.18163C>T
NM_182977.3   c.385C>G
NM_182977.3   c.385C>T
NM_182977.2   c.385C>G
NM_182977.2   c.385C>T
NM_012343.3   c.

Protein Summary

• Protein general information: P01100  
  • Name: Proto oncogene c Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7)
  • Length: 380  
  • Mass: 40695
• Sequence:

  MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQW
  LVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMA
  AAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTG
  GLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
  ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSP
  TLLAL

• Structural information:
  • Protein Domains: (137..20-)
    (/note="bZIP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00978"-)
  • Interpro: IPR000837  IPR004827  IPR029816  
  • Prosite: PS50217 PS00036
  • PDB: 1A02 1FOS 1S9K
  • PDBsum: 1A02 1FOS 1S9K
  • DIP: 1047
  • STRING: ENSP00000306245
• Other Databases: GeneCards:  FOS  Malacards:  FOS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901216	positive regulation of neuron death	ISS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0008134	transcription factor binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0006306	DNA methylation	TAS	biological process
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0051090	regulation of DNA-binding transcription factor activity	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071277	cellular response to calcium ion	IEA	biological process
GO:0045672	positive regulation of osteoclast differentiation	IEA	biological process
GO:0035994	response to muscle stretch	IEA	biological process
GO:0031668	cellular response to extracellular stimulus	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0034097	response to cytokine	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0006366	transcription by RNA polymerase II	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0035914	skeletal muscle cell differentiation	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IEA	biological process
GO:1901216	positive regulation of neuron death	IEA	biological process
GO:0051591	response to cAMP	IEA	biological process
GO:0051412	response to corticosterone	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0035902	response to immobilization stress	IEA	biological process
GO:0032870	cellular response to hormone stimulus	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0030431	sleep	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0009629	response to gravity	IEA	biological process
GO:0009416	response to light stimulus	IEA	biological process
GO:0009409	response to cold	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0001661	conditioned taste aversion	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	ISS	biological process
GO:0070412	R-SMAD binding	IPI	molecular function
GO:0034614	cellular response to reactive oxygen species	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0060395	SMAD protein signal transduction	IDA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0001102	RNA polymerase II activating transcription factor binding	IPI	molecular function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	IMP	molecular function
GO:0003700	DNA-binding transcription factor activity	IMP	molecular function
GO:0032993	protein-DNA complex	IMP	cellular component
GO:0035976	transcription factor AP-1 complex	IMP	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0034614	cellular response to reactive oxygen species	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0071276	cellular response to cadmium ion	IMP	biological process
GO:0035976	transcription factor AP-1 complex	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:1901216	positive regulation of neuron death	ISS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0008134	transcription factor binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0006306	DNA methylation	TAS	biological process
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0051090	regulation of DNA-binding transcription factor activity	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071277	cellular response to calcium ion	IEA	biological process
GO:0045672	positive regulation of osteoclast differentiation	IEA	biological process
GO:0035994	response to muscle stretch	IEA	biological process
GO:0031668	cellular response to extracellular stimulus	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0034097	response to cytokine	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0006366	transcription by RNA polymerase II	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0035914	skeletal muscle cell differentiation	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IEA	biological process
GO:1901216	positive regulation of neuron death	IEA	biological process
GO:0051591	response to cAMP	IEA	biological process
GO:0051412	response to corticosterone	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0035902	response to immobilization stress	IEA	biological process
GO:0032870	cellular response to hormone stimulus	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0030431	sleep	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0009629	response to gravity	IEA	biological process
GO:0009416	response to light stimulus	IEA	biological process
GO:0009409	response to cold	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0001661	conditioned taste aversion	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	ISS	biological process
GO:0070412	R-SMAD binding	IPI	molecular function
GO:0034614	cellular response to reactive oxygen species	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0060395	SMAD protein signal transduction	IDA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0001102	RNA polymerase II activating transcription factor binding	IPI	molecular function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	IMP	molecular function
GO:0003700	DNA-binding transcription factor activity	IMP	molecular function
GO:0032993	protein-DNA complex	IMP	cellular component
GO:0035976	transcription factor AP-1 complex	IMP	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0034614	cellular response to reactive oxygen species	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0071276	cellular response to cadmium ion	IMP	biological process
GO:0035976	transcription factor AP-1 complex	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04010	MAPK signaling pathway
hsa05132	Salmonella infection
hsa04024	cAMP signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05130	Pathogenic Escherichia coli infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04921	Oxytocin signaling pathway
hsa05161	Hepatitis B
hsa04728	Dopaminergic synapse
hsa05224	Breast cancer
hsa04380	Osteoclast differentiation
hsa05418	Fluid shear stress and atherosclerosis
hsa05135	Yersinia infection
hsa04210	Apoptosis
hsa04926	Relaxin signaling pathway
hsa04725	Cholinergic synapse
hsa04935	Growth hormone synthesis, secretion and action
hsa05162	Measles
hsa04915	Estrogen signaling pathway
hsa05231	Choline metabolism in cancer
hsa04668	TNF signaling pathway
hsa04713	Circadian entrainment
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04660	T cell receptor signaling pathway
hsa04659	Th17 cell differentiation
hsa04620	Toll-like receptor signaling pathway
hsa04662	B cell receptor signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05142	Chagas disease
hsa04658	Th1 and Th2 cell differentiation
hsa01522	Endocrine resistance
hsa04657	IL-17 signaling pathway
hsa05323	Rheumatoid arthritis
hsa05210	Colorectal cancer
hsa05031	Amphetamine addiction
hsa05133	Pertussis
hsa04917	Prolactin signaling pathway
hsa05140	Leishmaniasis
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Colorectal adenoma	PMID:8264230
colorectal adenocarcinoma	PMID:8264230
Pick's disease	PMID:17548164
Rectal neoplasm	PMID:21975339
Cervical squamous cell carcinoma	PMID:15514944
autosomal dominant polycystic kidney disease	PMID:16049073
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospadias	MIK: 24778562

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
24778562	Hypospadias			13 (5 controls, 8 cases)	Male infertility	Microarray