• Gene id: 23529

Gene Summary

• Gene Symbol: CLCF1   Gene   UCSC   Ensembl
• Aliases: BSF-3, BSF3, CISS2, CLC, NNT-1, NNT1, NR6
• Gene name: cardiotrophin like cytokine factor 1
• Alternate names: cardiotrophin-like cytokine factor 1, B-cell stimulatory factor 3, B-cell-stimulating factor 3, CRLF1 associated cytokine-like factor 1, neurotrophin-1/B-cell stimulating factor-3, novel neurotrophin-1,
• Gene location: 11q13.2 (67374176: 67364167)     Exons: 4     NC_000011.10
• Gene summary(Entrez): This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic facto
• OMIM: 618070

Protein Summary

• Protein general information: Q9UBD9  
  • Name: Cardiotrophin like cytokine factor 1 (B cell stimulating factor 3) (BSF 3) (Novel neurotrophin 1) (NNT 1)
  • Length: 225  
  • Mass: 25176
  • Tissue specificity: Expressed predominantly in lymph nodes, spleen, peripheral blood lymphocytes, bone marrow, and fetal liver. {ECO
• Sequence:

  MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFN
  PPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGV
  MAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF

• Structural information:
  • Interpro: IPR009079  IPR010681  
  • DIP: 61204
  • STRING: ENSP00000309338
• Other Databases: GeneCards:  CLCF1  Malacards:  CLCF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007259	receptor signaling pathway via JAK-STAT	ISS	biological process
GO:0007166	cell surface receptor signaling pathway	ISS	biological process
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	TAS	biological process
GO:0008083	growth factor activity	TAS	molecular function
GO:0097058	CRLF-CLCF1 complex	IBA	cellular component
GO:0007259	receptor signaling pathway via JAK-STAT	IBA	biological process
GO:0005576	extracellular region	IBA	cellular component
GO:0097059	CNTFR-CLCF1 complex	IBA	cellular component
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IBA	biological process
GO:0030890	positive regulation of B cell proliferation	IBA	biological process
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048711	positive regulation of astrocyte differentiation	IEA	biological process
GO:0048295	positive regulation of isotype switching to IgE isotypes	IEA	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IEA	biological process
GO:0030890	positive regulation of B cell proliferation	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0030183	B cell differentiation	IEA	biological process
GO:0007259	receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0002639	positive regulation of immunoglobulin production	IEA	biological process
GO:0005125	cytokine activity	IDA	contributes to
GO:0005127	ciliary neurotrophic factor receptor binding	IDA	contributes to
GO:0005127	ciliary neurotrophic factor receptor binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0097058	CRLF-CLCF1 complex	IDA	cellular component
GO:0002639	positive regulation of immunoglobulin production	ISS	biological process
GO:0007259	receptor signaling pathway via JAK-STAT	ISS	biological process
GO:0030183	B cell differentiation	ISS	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IDA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IDA	biological process
GO:0097059	CNTFR-CLCF1 complex	IDA	cellular component
GO:0007166	cell surface receptor signaling pathway	ISS	biological process
GO:0030890	positive regulation of B cell proliferation	ISS	biological process
GO:0048295	positive regulation of isotype switching to IgE isotypes	ISS	biological process
GO:0048711	positive regulation of astrocyte differentiation	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0019221	cytokine-mediated signaling pathway	NAS	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0005125	cytokine activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Cold-induced sweating syndrome	KEGG:H00935
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq