• Gene id: 2352

Gene Summary

• Gene Symbol: FOLR3   Gene   UCSC   Ensembl
• Aliases: FR-G, FR-gamma, FRgamma, gamma-hFR
• Gene name: folate receptor gamma
• Alternate names: folate receptor gamma, folate receptor 3 (gamma),
• Gene location: 11q13.4 (72135724: 72139891)     Exons: 5     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the folate receptor (FOLR) family of proteins, which have a high affinity for folic acid and for several reduced folic acid derivatives, and mediate delivery of 5-methyltetrahydrofolate to the interior of cells. Expression of
• OMIM: 601814

Protein Summary

• Protein general information: P41439  
  • Name: Folate receptor gamma (FR gamma) (Folate receptor 3)
  • Length: 245  
  • Mass: 27885
  • Tissue specificity: Spleen, thymus, bone marrow, ovarian carcinoma, and uterine carcinoma.
• Sequence:

  MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELH
  KDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSY
  TCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEV
  AKFYAAAMNAGAPSRGIIDS

• Structural information:
  • Interpro: IPR004269  IPR018143  IPR032934  
  • STRING: ENSP00000481114
• Other Databases: GeneCards:  FOLR3  Malacards:  FOLR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0031362	anchored component of external side of plasma membrane	IBA	cellular component
GO:0005542	folic acid binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005542	folic acid binding	IEA	molecular function
GO:0005542	folic acid binding	TAS	molecular function
GO:0015884	folic acid transport	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0019898	extrinsic component of membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0035580	specific granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa01523	Antifolate resistance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881